KEGG   Selenomonas ruminantium: SELR_25610Help
Entry
SELR_25610        CDS       T01799                                 

Gene name
pfkA
Definition
(GenBank) putative 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sri  Selenomonas ruminantium
Pathway
sri00010  Glycolysis / Gluconeogenesis
sri00030  Pentose phosphate pathway
sri00051  Fructose and mannose metabolism
sri00052  Galactose metabolism
sri00680  Methane metabolism
sri01100  Metabolic pathways
sri01110  Biosynthesis of secondary metabolites
sri01120  Microbial metabolism in diverse environments
sri01130  Biosynthesis of antibiotics
sri01200  Carbon metabolism
sri01230  Biosynthesis of amino acids
sri03018  RNA degradation
Module
sri_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELR_25610 (pfkA)
   00030 Pentose phosphate pathway
    SELR_25610 (pfkA)
   00051 Fructose and mannose metabolism
    SELR_25610 (pfkA)
   00052 Galactose metabolism
    SELR_25610 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SELR_25610 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SELR_25610 (pfkA)
Enzymes [BR:sri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SELR_25610 (pfkA)
Protein phosphatases and associated proteins [BR:sri01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SELR_25610 (pfkA)
Messenger RNA biogenesis [BR:sri03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SELR_25610 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat UPRTase Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAL84269
UniProt: I0GU32
Position
complement(2705297..2706262)
Genome map
AA seq 321 aa AA seqDB search
MIKKAIAVMTSGGDSPGMNAAARAVVRTALHEGVKVYGIYDGYAGMIDDRIEELTSRSVS
DLIQRGGTFLGTARSMEFKTPEGRKKGFDNLVKRGIEGLVIIGGDGSLTGGSLLSKETGM
PIVGLPGTIDNDVWGMDYTIGCDTAANTIVDAINKLRDTASAHRRIMLVEVMGRNSGWLA
MMAGIAGGAEYVLVPEVKYDLDEICHELKAMYDAGKRYSIIVVAEGAGSAVGLGKVVEDK
TGIDTRVSVLGHIQRGGSPTIEDRIKASMLGEKAALAIISGATNLVFGFNEGKVVGVNLF
DAVNNNKTLNPELVRLARVLA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcaattgccgtaatgacttctggcggcgacagcccggggatgaatgcg
gcagcccgcgccgtagtacgtactgccctgcatgaaggggtaaaggtctatggtatctat
gatggttacgccggcatgatcgatgaccgcatcgaggaactcacgagccgcagcgtgtcc
gatctgatccagcgcggtggtaccttcctgggcacggcccgcagcatggagttcaagact
cccgaaggccgtaagaaaggcttcgacaacctggtgaagcgtggcattgaaggtcttgta
atcatcggcggtgacggttcccttaccggcggctctctcctgtccaaggaaacgggaatg
cctatcgttggtctgccgggcaccattgacaacgacgtatggggcatggattacaccatt
ggctgcgatacggctgccaacaccatcgtcgatgccatcaacaagctgcgcgacacggct
tctgcccatcgccgcatcatgctcgttgaggttatggggcgcaactccggctggctggct
atgatggccggtatcgccggtggtgctgagtacgttctcgtaccggaagtgaaatatgac
ctggacgaaatctgccatgaactcaaggctatgtatgatgccggcaagcgctacagcatc
atcgtagtggctgaaggcgcaggctctgctgtaggcctgggcaaagtggtggaggacaag
acgggcatcgatacccgtgtatcggttctcggtcatattcagcgtggtggttccccgacg
attgaagaccgtatcaaggcttccatgctgggtgaaaaggcagctttggccatcatctcc
ggtgctacgaatctggtctttggcttcaatgaaggcaaggttgttggcgtaaatctcttt
gatgctgtcaataacaataagaccttgaatccggaactggtacgtttggcgagagtgctg
gcataa

DBGET integrated database retrieval system