KEGG   Selenomonas ruminantium: SELR_26280Help
Entry
SELR_26280        CDS       T01799                                 

Gene name
glpK
Definition
putative glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sri  Selenomonas ruminantium
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sri00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2775625..2777121)
Genome map
AA seq 498 aa AA seqDB search
MSEKYVLALDSGTIKNRAVIFNSKGEMVSYAEKKISVNKPHKGWVEQDPDEIWSTQIWTA
KEAIQLANISHRDIAGIGVTNQRETTIVWNKNTGRPVYPAISWESQQTEGICKRLVEQGL
QEEIRQKTSLIINPYFSATKLCWILENVLGAREMAEKGELLFGTVDTWLMWKLSGGEIFA
TDYSNASRTMMFNLRKLEWDAEILEHLGIPRRMLPEVCPSSHVFGETDAAMIGSRIPIAG
CLGNQQADLFGEACFKKGMAKNTYGEGSFFLMNAGKKYHSSQNGLITTIAWGIGKEITYA
LEGSVFVSGATLKWVKEGLGLIDSMSDSEWLAKQVPDSDGVYFVPAFRGLSAPYWDTETT
GMIIGINEDTQRAHIVRAALEALAYQVRDVYESVVSDTGLEIKSLHVDGGASQNHALMQF
QADLLNIPVIRPYIAETTALGAAFMAGLATGVWESVDELKKLWREGMRFKPAMSERGRAA
LYDGWQEAVSRVMGWPNK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaagtatgttttggcgctggattcagggacgatcaagaaccgcgccgttatt
ttcaactctaagggagaaatggtttcctatgcggagaagaaaatcagtgtgaacaagccc
cacaagggatgggtggagcaggatccggatgagatctggagcacccagatatggacggcc
aaggaagccatccagctggcgaatatctcccatcgggacattgcaggcattggggtgacc
aatcagcgggaaaccaccatcgtctggaacaagaacacggggcgtcccgtttatccggcc
atcagttgggaatcccagcagacggaaggcatctgcaagcggttggtagagcaggggctg
caggaggaaatccggcaaaagacttccttaataataaacccctatttttccgccacgaaa
ctctgctggatcctggaaaatgtgctgggggcacgggagatggcggaaaagggcgaactg
ctgtttggcaccgtggacacctggctcatgtggaagctcagcggcggcgagatctttgcc
acggattattccaatgcttcccgcaccatgatgttcaatctgcgcaagctggaatgggat
gccgagatactcgaacatctgggcattccccgcaggatgctgccggaggtctgtccttcc
agccatgtgtttggcgaaacagatgcggctatgattggttctcgcattcccattgcgggc
tgtctcggcaatcagcaggcggatcttttcggtgaggcctgctttaagaagggcatggcc
aagaatacctatggggaaggctctttcttcctgatgaatgcgggcaagaaataccatagc
tcccagaatggtctgattactacaatcgcctggggcatcggcaaggaaatcacctatgcg
ctggagggcagtgtctttgtgtccggcgccaccctgaagtgggtgaaggaaggtctgggg
cttatcgattccatgtccgattccgaatggctggccaagcaggtgccggattcggacggt
gtgtatttcgtgccggccttccgcggattatctgcgccctattgggacacggaaaccacg
ggcatgatcatcggcatcaatgaggacacccagcgggcccatatcgtgcgggccgctttg
gaggctttggcttatcaggtgcgggatgtctatgaatccgtggtgtccgatacagggctg
gaaatcaagagcctccatgtggatggcggtgccagccagaatcatgccctgatgcagttc
caggcggatcttttgaatatcccggtgatccgtccttacattgcagaaaccacggcgctg
ggggctgcctttatggccggcctggctacgggcgtctgggaaagcgtggacgaactgaag
aaactctggcgggaagggatgcgcttcaagccggctatgagcgagcggggcagagctgct
ctctacgacggctggcaggaagcagtttcccgcgttatgggctggccgaacaagtaa

DBGET integrated database retrieval system