KEGG   Selenomonas ruminantium: SELR_27270Help
Entry
SELR_27270        CDS       T01799                                 

Gene name
folP
Definition
putative dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sri  Selenomonas ruminantium
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sri00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2888695..2889555)
Genome map
AA seq 286 aa AA seqDB search
MTVARNYTFADGKTLTLGERTLVMGILNVTPDSFSDGGQFNTVDKALRHLEEMVADGADI
IDVGAESSRPGFVTMPASEEIERLMPFLEAVLKNSPVPVSVDTFKAETAREAAKAGAHIL
NDIWGLQYEKEPGAMAKVAAECGLPVIVMHNQNGTEYSGDIIESMQAFFRESLRIGREAG
MKDEQFIFDPGIGFGKTAEQNVEVLRRQEELLTVAGQEYPLLLANSRKSFIGKTLDLPVD
ERMEATGASCVIGIMKGASIVRVHDVKPIVRMCRMTDVILRSGENG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgactgtagcacgaaattatacttttgccgatggtaagacgctgactttaggggaacgc
acgttggtgatgggaatcctgaacgtcaccccggattccttttccgatggcggccagttc
aatacggtggacaaggctttgcgccatctggaggaaatggtggctgatggggcagacatc
atcgatgtgggcgccgaatccagccgcccgggctttgtgaccatgccggccagcgaggaa
atcgagcggctgatgcccttcctggaggccgtgctgaaaaattccccggttcccgtgtcc
gtggataccttcaaggcagaaactgcccgggaggctgccaaggccggcgcccatatcctc
aacgatatctggggcctgcagtacgaaaaggaaccgggggccatggccaaagtggctgct
gaatgcggtctgccggtcatcgtcatgcacaatcagaatggcacggaatacagcggcgat
atcatcgagtccatgcaggcctttttccgggagtccctgcgtattggccgggaagcgggc
atgaaggatgagcagttcatcttcgatccgggcattggctttggcaagactgccgagcag
aatgtggaggtcctgcggcggcaggaagaactgctgacggtggccgggcaggaatatccg
ctgctgctggccaacagccgcaagagctttatcggcaagacattggacttgccggtggac
gaacgcatggaagccacgggagcgtcctgtgtgattggcatcatgaagggggccagcatc
gtgcgggtgcatgatgtgaagcccattgtacggatgtgccggatgacggatgtgatttta
aggagtggggaaaatggataa

DBGET integrated database retrieval system