KEGG   Selenomonas ruminantium: SELR_27280Help
Entry
SELR_27280        CDS       T01799                                 

Gene name
folE
Definition
putative GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sri  Selenomonas ruminantium
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sri00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2889552..2890118)
Genome map
AA seq 188 aa AA seqDB search
MANERAIKAMSEFLAAIGVDIEARGMEKTPARVAQMYEFLFNGMDKDTADIWGETFDAGS
DGIVAVRHVPFYSMCEHHLVPFFGEASIAYLPENGRVAGFSKFSKLVEQISHQPQLQERL
TAQIAAAVQKDLGARGVLVIVEAQQLCMTMRGDLAHGTRTVTSECNGVFKQDTALYQQAW
MILGGEKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaatgaacgggcgataaaggccatgagtgaatttttggcagctataggcgtggat
atagaggcacggggcatggaaaaaacccctgccagagtggcgcagatgtatgagttcctg
ttcaatggtatggacaaggatacggcagatatctggggagaaacctttgatgcgggttct
gacggcattgtggccgtgcgtcatgtgcccttttactccatgtgtgagcatcatctggtg
ccgttctttggcgaggccagcatcgcttatttgccggaaaatggacgggtggccggtttc
agcaagttctcgaaactggtggaacagatttcccatcagccccagctgcaggaacggctt
accgctcagattgcggcggccgtacagaaagatttgggggcacggggggtgctggtcatc
gtggaagcccagcagctctgcatgaccatgcggggagatttggcccatggcacccgtacg
gtgacttccgaatgcaacggtgtcttcaagcaggataccgctctttatcagcaggcgtgg
atgattctaggaggagaaaaggcatga

DBGET integrated database retrieval system