KEGG   Selenomonas ruminantium: SELR_pSRC101070Help
Entry
SELR_pSRC101070   CDS       T01799                                 

Gene name
thrC
Definition
(RefSeq) putative threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sri  Selenomonas ruminantium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELR_pSRC101070 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELR_pSRC101070 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SELR_pSRC101070 (thrC)
Enzymes [BR:sri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SELR_pSRC101070 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSRC1:89384..90448
Genome map
AA seq 354 aa AA seqDB search
MKYVCSKCGHEEDVQILKIKCDCGGLWKLDFQPPKFSRDLIDQDTWSIFRYRKFMALPDE
SWRQVSLGEGMTPIIPLDEDVLVKMDYYMPTLSFKDRGAAVLVAYMKWLGVKHAVQDSSG
NAGSSVAAYAGRVGIDCEIFVPEGTSDKKIRMIEAHGAKANVVPGNRDHCADVCRAKVEN
EGVYYANHVYNPFFYEGTKTYIYETFEQLGRIPEHIFIPLGNGTLFIGVMKGLEELLASG
AIDHFPQVVIVQSERCQPFIKAMEKGGHDISPEPVERTQAEGIAIGLPMRGAEILDYIYR
YKVKAATIPEDKILAAREKLSSRGIYAEHTTAAVYDGGSGLVSPAGANCCGGAK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgtatgcagcaaatgcggtcatgaagaagatgttcagatactgaagataaaa
tgcgattgcggcggcttgtggaagctggacttccagccgcctaagttcagccgggatttg
attgaccaggatacctggagcattttccgctatcggaagtttatggctttgcctgatgaa
agctggcggcaggtttctctgggtgaggggatgacccccatcattccgttggatgaagat
gtgctggtgaagatggactattatatgcccaccctttccttcaaggaccggggggctgcc
gtattggtggcttatatgaaatggctgggggtcaaacatgccgttcaggatagcagcggc
aatgccggtagcagtgtggctgcttatgctggccgcgtgggcatagattgcgaaatcttc
gttcccgagggaacctccgacaaaaagatccggatgattgaggcacatggcgccaaggca
aatgtggttcccggtaatcgggaccattgtgccgatgtctgccgggctaaggtggaaaat
gaaggcgtgtattatgccaaccatgtgtataatccctttttctacgagggaaccaaaact
tatatatacgaaacctttgagcagttgggcagaattccggagcatatcttcatcccgctg
ggcaatggcaccctgttcatcggcgtcatgaaagggctggaggagctgctggccagcgga
gccatcgaccatttccctcaggtcgtgattgtgcagagtgaacgctgtcagccctttatc
aaggccatggaaaaaggcggtcatgacatttctccggagccggtggaacgcacgcaggca
gagggaatcgctatcggcttacccatgcggggcgcagagattctggactatatttatcgc
tacaaagtgaaggcggccaccattcctgaggacaagattctcgctgcccgggaaaagctg
tccagcaggggtatatatgcagaacataccaccgctgctgtatatgacggcggatctgga
ctggtgtctccagcaggagcgaattgctgtggcggagctaaataa

DBGET integrated database retrieval system