KEGG   Selenomonas ruminantium: SELR_pSRC200190Help
Entry
SELR_pSRC200190   CDS       T01799                                 

Definition
putative esterase/lipase family protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sri  Selenomonas ruminantium
Brite
Enzymes [BR:sri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SELR_pSRC200190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSRC2:complement(16246..16995)
Genome map
AA seq 249 aa AA seqDB search
MLIEGAESFFLPGDGQKKAVLLVQGFAGNTAELWPMGKFLEAKGYTVLAPRLPGHGTKVE
DLLRTNADDWLDAVRDGYSVLRGLAKDIVVIGGSMGGSLGLILSAEKQVKGVVTLAAPIF
IAQEQGISALPPKEMLTSSDFTPENKRNLVNVPKAANLIYDKIPLLSVYDLLEVIERSKK
CLPKITAPSLIVHGKDDTMAAVESAQYIGEHIGSSRKKVVLLDGAGHLLPLMEGREAVFE
KISSFLDTL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttattgaaggtgcagaatcattttttctccctggagatggtcaaaagaaagccgtg
cttttggtgcagggatttgctggaaataccgctgagctttggccaatggggaaattcttg
gaagccaaaggatatacagtgcttgcaccaagacttcctgggcatggaacaaaggtagaa
gaccttcttcggacaaatgctgatgattggctggatgccgtgcgggacggctattctgtt
ctccgtggcttggccaaagatattgtagtaatcggcggctccatgggaggaagccttggc
cttattttgtcagcggaaaaacaggttaaaggggtggtcacattagcggcacctattttc
attgcacaggaacagggcatttctgcccttccgcccaaggaaatgctgacatcttcagat
tttacacctgagaataagcggaacctcgtaaatgttcccaaagccgctaatttgatttat
gataaaatcccccttctttctgtttatgatcttcttgaagttatagagcgtagcaaaaaa
tgtctgcccaaaattaccgctccctccttaatcgttcatggtaaagatgatacgatggcg
gcggttgaaagtgcccaatatattggagagcatattggcagcagtcggaagaaagtagtt
ttgcttgatggagcagggcatttgcttcccttaatggaaggtcgggaggctgttttcgag
aaaataagcagtttcttagatacgctttga

DBGET integrated database retrieval system