KEGG   Selenomonas ruminantium: SELR_pSRC200810Help
Entry
SELR_pSRC200810   CDS       T01799                                 

Gene name
bsaA
Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sri  Selenomonas ruminantium
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SELR_pSRC200810 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SELR_pSRC200810 (bsaA)
Enzymes [BR:sri01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SELR_pSRC200810 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSRC2:complement(62143..62688)
Genome map
AA seq 181 aa AA seqDB search
MGIYDFVVKTNKGVEKSLADYKGKVLVIVNTASKCGFTPQFKELQDLYMKYKGQGLEILG
FPCNQFAGQEPGSNNEVQEFCRLNYGVTFQIFEKGDVRGETAQPLFKYLIEQQGFKGFDQ
DHPIAAKLTEALQQNFPEYLEGDSIKWNFTKFLVDREGNVVARFEPTFDPANMAGEIEKL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttatgattttgtggtaaagaccaataaaggtgtagaaaaatctctggctgat
tacaagggcaaggtgctggtcatcgtcaatacggcctccaaatgcggtttcacaccccag
ttcaaggaactgcaggacctctatatgaagtataagggccagggcctggaaatcttaggc
ttcccctgcaatcagttcgctggtcaggaacctggcagcaataatgaggtgcaggaattc
tgccgcctgaactacggcgtgacctttcagattttcgagaaaggcgatgtccggggcgaa
acggcacagccgctgttcaagtacctgattgaacagcagggcttcaagggctttgaccag
gaccatcccattgctgcgaagcttacggaagcactccagcagaatttccccgaatatctg
gaaggcgactccatcaaatggaatttcactaagttcctggtagacagagagggcaacgta
gtagcccgcttcgagcccacttttgaccctgcaaacatggcaggggaaattgaaaagctg
ttgtaa

DBGET integrated database retrieval system