KEGG   Serratia plymuthica 4Rx13: SOD_c00450Help
Entry
SOD_c00450        CDS       T02710                                 

Gene name
fdoH
Definition
(GenBank) formate dehydrogenase-O iron-sulfur subunit FdoH
  KO
K00124  
formate dehydrogenase iron-sulfur subunit
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SOD_c00450 (fdoH)
  Energy metabolism
   00680 Methane metabolism
    SOD_c00450 (fdoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
50928..51827
Genome map
AA seq 299 aa AA seqDB search
MAMQSQDIIRKSATNGFTPAPRARDHQEEVAKLIDVTTCIGCKACQVACSEWNDIRDEIG
SNVGVYDNPADLTAKSWTVMRFSEVEENGKLEWLIRKDGCMHCADPGCLKACPSEGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCTLCVDRVDVGQEPACVKTCP
TGAIHFGTKDAMKQIAAERVGELNTRGYQNAGLYDPAGVGGTHVMYVLHHADKPQLYHGL
PNNPTISPAITFWKGVWKPLAAIGFAATFAASVFHYVGVGPNRVEEEDNDELHDEETRK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcaatctcaggacatcattcgtaaatccgccaccaatggtttcacgccggcc
ccgcgcgcccgtgaccatcaggaagaagtggccaaacttatcgatgtcaccacctgtatc
ggctgcaaggcctgtcaggtggcctgttccgaatggaacgacattcgcgatgaaatcggc
agcaacgtcggggtgtacgataaccccgccgatctgaccgccaagtcgtggacggtcatg
cgcttctccgaagtggaggaaaacggcaagctggaatggttgatccgcaaggacggctgc
atgcactgcgccgatccgggttgcctgaaggcttgcccgtcggaaggcgcaatcattcag
tacgccaacggcatcgtcgacttccagtccgagcactgcatcggctgcggctactgcatc
gccggctgcccgttcgacgtgccgcgcatgaacaaggacgacaaccgggtgtacaaatgc
accctgtgcgtcgaccgcgtcgatgtcggccaggaaccggcctgcgtgaagacctgcccg
accggcgcgattcatttcggcaccaaggacgcgatgaagcagattgccgccgagcgcgtc
ggcgagctgaacacccgcggttatcagaacgccggtctgtacgatccggcgggcgtgggc
ggcacccacgtgatgtatgtgctgcaccacgccgacaaaccgcagctgtatcacggtttg
ccgaataacccgaccatcagcccggcgatcacgttctggaaaggcgtgtggaaacccctg
gcggccatcggctttgccgccacctttgcagccagcgtgttccactatgtcggcgtcggg
ccaaaccgcgtcgaagaggaagacaacgacgagctgcacgatgaggagacgcgcaaatga

DBGET integrated database retrieval system