KEGG   Serratia plymuthica 4Rx13: SOD_c00490Help
Entry
SOD_c00490        CDS       T02710                                 

Gene name
yibF
Definition
(GenBank) putative GST-like protein YibF
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
54197..54802
Genome map
AA seq 201 aa AA seqDB search
MKLIGSYTSPFVRKISVMLLEKGIAFEFVNDPPYEPGSRVVELNPLAKVPVLVADDGVAY
YDSRVIAEYLELLPAAPAFLPADRAAALRIRQVEALADGVTEAAATLFRESKRAPEKQDE
NWILRQRDKLTHGLDALEKLAQEKTLLNAAELTLADIATGCALGYLNFRRIMPNWCVERP
ALIKLAERLFARESFARTSPP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgattggcagttataccagcccttttgtacgcaagatttccgtgatgttgctg
gaaaaggggatcgcgttcgaattcgttaacgatccgccgtatgagccgggcagccgggtg
gtggagctgaatccgctcgccaaggtgccggtgctggtggccgatgacggcgtggcttat
tacgactcgcgcgtcattgccgaatacctcgaactgcttcccgccgccccggcatttttg
cccgccgatcgcgcggctgcgctgcgcattcgccaggtggaagcgctggccgacggcgta
accgaagccgccgccacgctgtttcgcgagagcaaacgcgcgccggaaaaacaggacgaa
aactggatactgcgccagcgcgacaaactgacgcacgggctggacgcgctggagaagctg
gcgcaggaaaagacgctgctgaacgccgccgagctgacgttggcggacatcgctaccggc
tgtgcgctgggctacctcaatttccgccgcatcatgcccaactggtgcgtcgaacggcct
gcgttgatcaaactggccgagcggctgtttgcccgcgaaagttttgcccgcacttcaccc
ccctga

DBGET integrated database retrieval system