KEGG   Serratia plymuthica 4Rx13: SOD_c00640Help
Entry
SOD_c00640        CDS       T02710                                 

Gene name
cynX
Definition
(GenBank) cyanate transport protein CynX
  KO
K03449  
MFS transporter, CP family, cyanate transporter
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transporters [BR:srl02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    SOD_c00640 (cynX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
73094..74236
Genome map
AA seq 380 aa AA seqDB search
MGAGADWPEYAALVDLDWPAVADAAAGHRAELWRRCAADHPAGADDGADGAGGWGDQPPV
QRTDQRGAEPAGIGLGAAWRELAPGSAQLMLSAVLGGLGIGVIQAVMPGIIKHHFLKRMA
LVAGLWSAALMGGGGLGAAITPWLMSAGHDWHSALAWWAAPALVALLAWWPVSRGLARLA
PSGASAGPNLLFSRRAWLLGAYFGLINGGYTSLIAWLPPYYMQLGWQPQASGTLLALMTF
GQVIGALLLPAVARAQDRRPLLWLALVMQLIGFIGLIYLPQTLPWLWVVIAGLGLGGAFP
LCLVLALDHIPHPAAAGRLVAFMQGIGFLLAGVTPYLSGLLRDYSGGFVLDWQIHALLVV
ALIAITGRFHPRSYRQALRE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgctggtgctgattggcctgaatatgcggcccttgttgacctcgattggcccgct
gttgccgacgctgcggcaggccaccgggctgagctttggcggcgctgcgctgctgaccac
cctgccggtgctgatgatggggctgatggcgctggcgggtggggcgatcaaccgcctgtt
cagcgaacggaccagcgtggtgctgagcctgctggcatcggcctcggtgccgcctggcgc
gaactggcaccgggcagcgcgcaactgatgctgagcgcggtgctgggcggcctggggatt
ggggtgatccaggcggtgatgcccggcattatcaagcatcactttctcaagcggatggcg
ttggtggccgggctgtggtcggcggcgctgatgggtggcggcggactgggagcggcgata
acgccgtggctgatgagcgccgggcatgactggcacagcgcgttggcttggtgggctgca
ccggcactggtggcgttgctcgcctggtggccggtcagccgtgggttggctcgccttgcg
ccatccggcgcttccgccggcccgaacctgctgttcagccgccgcgcctggctgttgggc
gcttattttggtttgatcaacggcggttataccagtctgatcgcctggctgccgccgtat
tacatgcagcttggctggcagccgcaggccagcggaacgctgctggcgctgatgaccttc
ggccaggtgattggcgcgctgttgctgccggcggtggcgcgggcgcaggatcgtcggccg
ctgttatggttggcgctggtgatgcaactgatcggttttatcggcctgatttacctgccg
cagacgctgccgtggctgtgggtagtgatcgccggcctggggctgggtggggccttcccg
ctgtgcctggtgctggcgctcgatcatatcccgcacccggcggcggcggggcggttagtg
gcgtttatgcagggcatcggttttttgctggcgggggtgacgccgtatctttccggcctg
ctgcgcgactacagcggcggctttgtgctggactggcaaatccatgcgctgctggttgtg
gcgttaatcgccatcaccgggcgttttcatccgcgcagctaccggcaggcattacgcgaa
taa

DBGET integrated database retrieval system