KEGG   Serratia plymuthica 4Rx13: SOD_c00850Help
Entry
SOD_c00850        CDS       T02710                                 

Gene name
oprB
Definition
(GenBank) porin B
  KO
K07267  
porin
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transporters [BR:srl02000]
 Other Transporters
  Pores ion channels [TC:1]
   SOD_c00850 (oprB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
96510..97904
Genome map
AA seq 464 aa AA seqDB search
MKYPLPHTGTLAALLLFCSGVQAKTLQTGKDVEAPTAQWDGVALGFEPPSPGLLGDMLGI
RPILEESGFHYNLGYLSQLSYNAGGGYNQDKQASYIDQFSLTFSQDLQTLTGIPDAAIEG
NIVNRNHDNNLTRDRLQDPRANPTDLSQESYGGQSITRLGWLTFSRSFLDRRLQWRIGMM
NKVQDFDQIIPCDFQTLALCGGKSANSLTWYNWNVHYWGTTLQYKLTDGLTFKTGVMEQN
PNATSRGHAWSTTTKGSKGFLLPMELELKTNAVNQLPGVYNIGVLFTNARQQDLYEGVSG
GAGATDPNGYRNHNRTWFLYSGFNQQVTRHRDDASRGLSLFYSLGLADQRTNYMHYSTST
GIRYHGLFDARPDDWLGLGVSMVKLSDHYRDNQRYMNQINQVTDYQDPNYRPVPGHSVTA
ELFYRFNVTPWLQLQPGLQYWHHPAGVSETQDAWVTALKTVVTF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccattacctcacaccgggacactcgcggcactgctgctgttttgcagcggc
gtgcaggcgaaaacgctgcaaaccggcaaagacgtcgaagcgccaaccgcccaatgggat
ggcgtggcgctcggtttcgaaccgccttcgccggggttgctgggcgatatgctggggatc
agaccgatcctcgaagagagcggcttccactataacctcggctatctcagccagctgtcg
tataacgccggcggcgggtataaccaggataagcaggcttcgtatatcgatcagttctcg
ttgaccttcagtcaggatttgcagacgctgaccggcatcccggacgcggccattgagggc
aatatcgtcaaccgcaaccacgacaataacctgacgcgcgatcgtttgcaggatccgcgc
gccaatccgaccgatctgtcgcaggaaagttatggcggccagtcgatcacccggctgggc
tggctgaccttcagccgcagttttctcgatcgccggttgcagtggcgcatcggcatgatg
aacaaggtgcaggatttcgatcagatcattccctgcgatttccagacgctggcgctgtgc
ggcggcaagtccgccaactcgctgacctggtataactggaacgtgcactactggggcacc
accctgcaatacaaactgaccgacgggctgacgttcaaaaccggcgtgatggagcagaac
ccgaacgccacgagccgcggccatgcctggagtaccaccaccaagggcagcaagggcttt
ttactgccgatggaactggagctgaaaaccaatgcggtcaatcagttgccgggggtgtac
aacatcggtgtcctgttcaccaacgccaggcagcaggatctgtatgaaggggtttccggt
ggggcgggcgcgaccgatccgaacgggtatcgcaaccataaccgtacctggttcctgtac
agcggttttaaccagcaggtgacgcgccaccgtgatgacgccagccggggtttgagcctg
ttctacagcttggggctggcggatcagcgcaccaactatatgcactattccacctcgacc
ggcattcgctaccacggcctgttcgacgcgcggccggacgactggctggggctgggggta
tctatggtcaagctgagcgatcattatcgggataatcagcgttatatgaatcaaatcaac
caggttaccgattatcaggatcccaactatcgcccggtgccggggcattcggtgacggcg
gagctgttctatcgcttcaacgtcaccccttggttacagttgcagccgggtctgcaatac
tggcatcacccggcgggcgtcagcgaaacgcaggacgcctgggtgacggcgttgaaaacg
gtggtgacgttctga

DBGET integrated database retrieval system