KEGG   Serratia plymuthica 4Rx13: SOD_c01020Help
Entry
SOD_c01020        CDS       T02710                                 

Gene name
bcsE
Definition
(GenBank) cellulose biosynthesis protein BcsE
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(116300..117871)
Genome map
AA seq 523 aa AA seqDB search
MAQSFSLGIRQIWEELSVMQSPGLYWVNVDRQTDAALLCQQTLAAQAATSQVALICSGDK
PDKLLAELASPALKKIPLYQLPEKKAALTHFCDDLMRALKPQNRLLILLAHASLWQTFTT
EELRDWARTTGHWLHRQGCTLLILSHGSGVNKLKGQLSTQHRILNGLANLQWQQDSAQYL
VNWWSTGNGINANQLLTLFAGENGWQGDDDGNQPSPTSIRSDEGLYLAQQSILEGAPPLS
ANWQLLESNAQLAQHGMLTLSATLIFALYQSDEIDVLAHQIHSLRRHRGNGLKIVVREMS
ASLRYSDERLLLACGANLTVPHVAPLSRFLTMLEGIQGQRFSRHVPADIDALLHGLRPLQ
LKGYMRPNDFSQAVISLMENTLLPEDGKGVMVALRPAPGLRAEQAMTLCHLRRFGDVMTV
VQGRLVLFLSTCRINDLDTALKFIFRLPVNEAFSNRVVWHQDVDITSEIKRLAHSANIPL
APQATKPSAPRQSAAVADSPQERRQPVAFTLTTGAQENKHAEP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatctttctcattaggtattcggcagatttgggaagaactgtcagtgatgcag
tcccccgggctctattgggtgaatgtcgaccgccaaactgatgccgctctgctctgccaa
caaaccctggctgcccaggccgcaaccagccaggtcgcgctgatctgcagcggagataaa
cccgacaaactgctggctgagctggcctcccccgcgctgaaaaaaattccgctgtaccag
ttaccggaaaaaaaagcggcgctgacgcatttctgcgatgacctgatgcgcgccttaaaa
ccgcaaaaccgcttattgatcctgctcgcccacgccagcctgtggcaaaccttcaccacc
gaagagttgcgcgactgggcccggaccactggccactggctgcatcggcaagggtgcacc
ctgttgatcctcagccatggcagcggcgtgaacaaactcaaagggcagctcagcacccag
caccgtattcttaacggcctggccaacctgcagtggcagcaagacagcgcacagtatctg
gttaactggtggagtacgggaaacggcatcaacgccaaccagctgctaacgctgttcgcc
ggtgaaaacggctggcagggggacgatgacggcaaccaaccttcgccaacctcgatacgc
agcgacgaaggcctctacctggcccagcaaagcattcttgaaggcgcgccgccgctgtcg
gccaactggcaactgttggaaagcaatgcgcaactggctcagcacggcatgctgacgctc
tcggcaacgctgatatttgcgctctatcagagcgatgagatcgatgtgctggcccatcaa
attcacagcctgcgccgccaccgcggcaacgggctgaagatcgtggtgcgcgagatgagc
gccagcctgcgctacagcgatgaacgcctgctgctggcctgcggtgccaacctgacggtg
ccgcacgttgcgccgctgtcgcgttttctgaccatgctggaaggcatccaggggcaacgc
ttctcacgccatgttccggcggatatcgacgccctgctgcacggcttgcgaccgctgcaa
ttgaaaggctatatgcgcccgaacgacttcagccaagcggtcatttcgctgatggaaaac
acgctgctgccggaagacggcaaaggcgtgatggtcgcgctacgccctgcgccggggctg
cgcgccgaacaggcgatgaccctgtgtcatctgcgccgcttcggcgacgtgatgaccgtg
gtgcaaggacggctggtgctgttcctatccacttgccggattaacgatctggacaccgcg
ttgaaatttatcttccgcctgccggtgaacgaggcgttcagcaaccgggtggtatggcac
caggatgtagatatcacttcagaaatcaaacggctggcgcacagcgccaatattccgtta
gcgccgcaggccaccaagccatccgcgccgcgccagagcgccgccgtggctgacagcccg
caggagcgccgtcaaccggtggccttcacgctgactaccggcgcacaggagaacaagcat
gctgaaccttaa

DBGET integrated database retrieval system