KEGG   Serratia plymuthica 4Rx13: SOD_c01040Help
Entry
SOD_c01040        CDS       T02710                                 

Gene name
bcsA
Definition
(GenBank) cellulose synthase catalytic subunit BcsA
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00500  Starch and sucrose metabolism
srl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SOD_c01040 (bcsA)
Enzymes [BR:srl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     SOD_c01040 (bcsA)
Glycosyltransferases [BR:srl01003]
 Polysaccharide
  Structural polysaccharide
   SOD_c01040 (bcsA)
Transporters [BR:srl02000]
 Other Transporters
  Others
   SOD_c01040 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: AGO53138
UniProt: S0A7X9
Position
118983..121586
Genome map
AA seq 867 aa AA seqDB search
MSRVMSLLLVPPVHQAVQTRYRTYRRNGSSAFSAFLATLLVALGWIFLRFESPDWQRVRA
SRAYWFPHLSFSRPRPADGLRYLLQGLWLLLFRTGRAPMGRHYFAGWHRLQLRYANWLQR
LPHRLQSAGMEQRSVERLSQMNRRMRRVLFIIVGVLAAILAMLCISQPFDLPAQFVFVVL
LWGIAMVVRRVPGRLPGLMLIVLSLTVSCRYLWWRYTATLNWDDPLSLICGLLLLAAETY
AWVVLVLGYFQTVWPLNRQPVPLPADSATWPTIDLMVPTYNEDLGVVKPTIYAALGIDWP
KEKVNIYLLDDGNRPEFKAFAEEVGVKYIARPTHEHAKAGNINNALKQATGEFVAIFDCD
HVPTRSFLQLTMGWFFKDKKLAMLQTPHHFFSPDPFERNLGRFRQTPNEGTLFYGLVQDG
NDMWDATFFCGSCAILRRSALDEIGGIAVETVTEDAHTSLRLHRRGHTSAYIRIPQAAGL
ATESLSAHIGQRIRWARGMVQIFRLDNPLFGKGLKLAQRLCYANAMLHFLSGIPRLIFLT
APLAFLLLHAYIIFAPALAIALYVLPHMIHASLTNSRIQGKYRHSFWSEIYETVLAWYIA
RPTTVALFNPHKGKFNVTAKGGLVEEEHVDWVITRPYMFLVVLNLAGLIFGAWRMAYGPT
DEVMTVIVSLVWVLYNMTILGGAVAVAVEAKQVRQAHRVEIAMPAAIARADGHLFPCTLR
DYSDGGVGIEMRVSDALKDGDKASLLLKRGQQEYSFPCVVTRAFGSKVGIRMVDLTTREH
IDFIQCTFARADTWALWQDGFPEDKPIESLRDVLALGFRGYLRMADYAPPMVRSLLVGFT
TMIAWIASFIPHGVGRNPAFSQKETVV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggtgatgagcctgttgctggtgccgccggtccatcaggcggtgcagacgcgc
tatcgaacctaccgccgtaacggatcctcggcctttagcgctttccttgccacgctgctg
gtggcgttgggctggattttcctgcgctttgaatccccggactggcagcgagtgcgcgcc
agccgcgcctattggttcccgcatttatccttcagccgcccgcgccctgcggatgggctg
cgttatctgttgcaggggctgtggctgctgctgtttcgcaccggtcgcgcgccgatgggc
cgtcattatttcgccggttggcaccgtctgcaactgcgttacgccaactggttgcaaagg
ctcccgcaccggttgcagagcgccgggatggagcagcgttcagtggaacgtctgagccag
atgaaccggcgcatgcgccgggtgctgtttatcattgtcggcgtactggcggcgatcctc
gccatgctgtgcatttcgcaacccttcgatttgccggcgcagtttgtgtttgtggtgctg
ctgtggggcattgcgatggtggtgcgccgggtaccgggccgtttgccggggctgatgctg
atcgtactgtcgttgaccgtttcctgccgctacctttggtggcgctacaccgccacgctg
aactgggacgatccgctcagcctgatctgcggcctgctgttgctggcggcggaaacctat
gcctgggtggtgttggttctgggctatttccagaccgtttggccgcttaaccgccagccg
gtgccgctgcctgccgacagcgcgacctggccgacgatcgatctgatggtgccgacctac
aacgaagatcttggggtggtgaaaccgacgatctacgccgcgctgggtatcgattggccg
aaagagaaggtcaatatctacctcctcgatgacggcaaccgaccggaattcaaagccttc
gccgaagaggtgggggtgaagtatatcgcccggccgacccatgagcatgccaaggccggt
aacatcaacaacgcgttgaagcaggccaccggcgagtttgtggcgatcttcgactgcgac
cacgtaccgacccgctccttcctgcaattgaccatgggctggttcttcaaagacaagaag
ctggcgatgttgcagaccccgcatcacttcttttcgccggatccgtttgagcgaaacctc
gggcgtttccgccagaccccgaacgaaggcacgctgttctacggcctggtgcaggacggc
aacgatatgtgggatgcgaccttcttttgcggctcttgcgccatcctgcgccgcagcgcg
ctggatgagataggcggcatcgcggtggaaaccgtcaccgaagatgcccacacctcgttg
cgtttgcatcgtcgcgggcacacctcggcctatatccgtattccgcaggccgccgggctg
gcgaccgaaagcctatcggcgcacattggccagcgcattcgttgggcgcgtggcatggtg
cagattttccggctggataacccgctgttcggcaaggggctgaaactggcgcagcggctg
tgttacgccaacgccatgttgcacttcttgtccggcattccgcggctgattttccttacc
gcgcctttggcgttcctgctgctgcacgcctatatcattttcgcccctgcgctggcgatc
gcgctctatgtgttgccgcatatgatccatgccagcctgaccaactcgcgcattcagggt
aaataccgtcactctttctggagcgaaatctacgagaccgtgctggcctggtatatcgcc
cgccctaccacggtggcgctgttcaatccgcacaagggcaaattcaacgtgaccgccaaa
ggcgggctggtggaagaggaacatgtcgattgggtgattacccgcccttacatgtttctg
gtggtgctcaatctggccggcctgatcttcggcgcctggcggatggcctacggcccgacg
gacgaagtcatgacggtgatcgtcagcctggtgtgggtgctgtacaacatgacgattctc
ggcggtgcggtggcggtggcggtagaggccaagcaggtgcgccaggcgcaccgcgtggag
attgccatgccggccgcgatagcccgcgccgatggtcacctgtttccttgcacgctgcgc
gactattccgacggcggggtagggattgaaatgcgcgtgtccgatgcgctgaaagacggc
gacaaggcatcgctgctgctaaaacgcggccagcaggaatacagcttcccgtgcgtggtc
acgcgcgccttcggcagtaaggtggggatccgcatggtcgatctcaccacccgtgaacat
attgattttattcagtgcacctttgcccgcgccgatacctgggcgctgtggcaggacggg
ttccctgaagataaaccgatcgaaagcctgcgcgacgttctggcgctgggcttccggggt
tacctgcgcatggcggactatgcgccgccgatggtgcgcagcctgctggtcggattcacg
acgatgattgcgtggatagcgtcattcatcccgcacggtgttggcaggaacccggctttc
agccaaaaagagacagtggtatag

DBGET integrated database retrieval system