KEGG   Serratia plymuthica 4Rx13: SOD_c01060Help
Entry
SOD_c01060        CDS       T02710                                 

Gene name
bcsZ
Definition
endoglucanase BcsZ (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SOD_c01060 (bcsZ)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SOD_c01060 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
123955..125067
Genome map
AA seq 370 aa AA seqDB search
MSATLKRLTFGMLLLCAFGASAACEWPAWQQYKQFYISDEGRVIDPSSPNRITTSEGQSY
GLFFALVANDRPAFDKLLEWTENNLAAGDLSAHLPAWLWGEDDKKRWTVLDTNTASDADL
WIAYNLLEAGRLWKSRRYQTLGTLLLQRIGREEVADIPGLGLMLLPGKIGFVAQDRWRLN
PSYLPPQLLARFAALNGPWRAMQKTNQRLLLETAPHGFSPDWVVWQAGKGWQPDTVKPDV
GSYDAIRVYLWVGMLADDDEHKAALVKQLLPMAQLTAQQGVPPEKTDTASGKTSGDGSVG
FSAVMLPMLANQTAALDVQRQRINQHPPGDDAYFSASLTLFGQGWDQQRYRFNRQGELQP
AWGGQCVTSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaacgctgaaacgcctgacgttcggtatgctgctgctgtgtgcattcggcgct
tcggcggcctgcgagtggccggcctggcaacagtacaaacagttttacatcagcgacgaa
ggacgggtgatcgacccgagcagcccgaaccgcatcaccacctcggaggggcagagctac
ggcctgttcttcgccctggtggcgaacgatcggccggcgttcgacaagttgcttgagtgg
acggaaaacaatttggcggcgggcgatctcagcgcccatttgcccgcctggctgtggggc
gaggacgataaaaaacgctggacggtgctggacacgaatacggcgtccgatgccgatctg
tggattgcctacaatctgctggaagccggtcgtttgtggaaaagccggcgttatcaaact
ctggggacgctgctgttgcagcgtatcggccgcgaagaagtggccgacatccccgggctg
gggctgatgttgctgccgggcaagatcgggttcgtggcgcaagatcgctggcggctcaat
ccaagctacctgccgccgcagctgctggcgcgttttgccgccctgaacggcccatggcga
gcgatgcagaaaaccaatcagcggttgttgctggaaaccgcaccgcacggtttctccccg
gattgggtggtgtggcaggccggcaaaggctggcaaccggataccgtgaaaccggatgtc
ggcagttacgacgccatccgggtttatttgtgggtcggtatgttggcggacgatgacgag
cataaagccgcattggtcaaacagctgctgccgatggcgcaattgaccgctcaacagggt
gtaccgccggaaaaaaccgacaccgccagcggcaaaaccagcggcgacggctcggtgggt
ttctccgcggtcatgctgccgatgctggccaatcaaacggctgcgctggacgtccagcgc
caacgcatcaatcaacaccctccgggcgacgatgcctatttcagcgcttctttgacgctg
ttcggccaaggatgggatcaacaacgttatcgttttaatcggcagggtgaacttcaaccc
gcctggggcggccaatgcgtaacttcaaaataa

DBGET integrated database retrieval system