KEGG   Serratia plymuthica 4Rx13: SOD_c05320Help
Entry
SOD_c05320        CDS       T02710                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:srl00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
577679..579001
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLNEAEIRFFINGIRDNVVSEGQIAALAMTIYFHDMTMPERVALT
MAMRDSGSVLDWKSLSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFNIFPDDNAFRKIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARAKL
QAVLDNGKAAEVFGRMVAAQQGPTDFVERYDSYLPAATLSKPVYAEKQGIISAMDTRALG
MAVVSLGGGRRRATDSIDYSVGLTGMARLGDKVDTQQPLAVIHANDEESWQQAAEAVRSA
MVLSDKAPEETPVVYKRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctggcacaagaaattattcgtaaaaaacgtgacggtcagccgttgaacgaggcg
gaaatccgctttttcatcaatgggatccgtgacaatgtggtttccgaaggtcagatcgcc
gcgctggcgatgaccatttatttccacgatatgaccatgccggagcgcgtggcgctcacc
atggcgatgcgtgattccggctccgtgctggattggaaaagcctgtcgttgaacgggccc
ctggtcgacaagcactccaccggcggcgtgggcgatgtcacttcgctgatgctcggcccg
atggtggccgcctgcggcggctacgtgccgatgatttccggccgcggtctgggccatacc
ggcggtacgctggacaagctggaggcgatcccgggttttaacattttcccggacgacaac
gccttccgcaaaattattcaggacgttggcgtggcgattatcggccagaccagctcgttg
gcaccggcggacaagcgtttctacgccacccgcgacatcaccgccaccgtggattcgatc
ccgctgattaccgcttctattctggcgaagaagctggcggaagggctggacgcgctggtg
atggacgttaaagtcggctccggcgcctttatgccgacctatgcgctgtcggccgatctg
gcgcaggcgatcgtcggcgtggccaacggcgcaggatgcaaaacgactgcgctgctgacc
gacatgaatcaggtgctggcctccagtgccggcaatgcggtggaagtacgtgaagcggtg
cgtttcctgaccggcgaataccgcaatccgcgcctgctggaagtgacgatggcgctgtgc
gtggaaatgctgctttccggcggtctggcgaaagatgacgccgacgcgcgcgccaagctg
caggcggtgttggacaatggcaaagcggcagaagtgtttggccgcatggtagcggcgcag
cagggcccgaccgatttcgtcgagcgctacgacagctatctgccggccgcgaccctgagc
aagccggtttacgccgaaaaacagggcattatcagcgcgatggacacccgtgcgctgggc
atggcggtggtatcgctgggcggcggtcgtcgccgtgcgaccgacagtatcgattacagc
gtcggcctgaccggcatggcgcgcctgggggataaagtggatacccagcagccgctggcg
gtgatccacgccaacgacgaagagagttggcagcaggcggccgaagcggtacgcagcgct
atggtgctgagcgacaaagcgccggaagaaacgccagtggtgtataagcgcatcacggaa
taa

DBGET integrated database retrieval system