KEGG   Serratia plymuthica 4Rx13: SOD_c12800Help
Entry
SOD_c12800        CDS       T02710                                 

Gene name
amyA
Definition
cytoplasmic alpha-amylase AmyA (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SOD_c12800 (amyA)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SOD_c12800 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1398664..1400154)
Genome map
AA seq 496 aa AA seqDB search
MTKKTTLLQFFHWYYPDGGKLWQEAAERAPHIAGLGITDLWLPPAYKGASGGYSVGYDSY
DLFDLGEFDQKGSRATKYGDKEALTHAAATLRDNGVRVIYDVVFNHKLGADEKEQVRVYR
ADVNNRNNINDQGFDALAYTRFTFPGRQGTYSKFIWDYKCFGGVDYIEQPDEKGVFKIDN
DYGDDGWNDQVGDEKGNYDYLMGADVEFRNTAVAEELKFWARWLMESLPCDGFRLDAAKH
IPAWFFKEWADHVRDAAQRDLFIVAEYWSHDLAALRQYIDLVDGKVMLFDVALHLKFHQA
SKQGDGFDMTQIFTDTLTAADPAHSVTLVANHDTQPLQSLEAPVEPWFKPLAYALILLRE
QGVPCVFYPDLYGASYKDKGGDGNEYQIDMPVIPELEKLIQARQRFANGVQTDYFNDRNC
VAFSRSGTADTPGCVVVLTNGAENGKAVSLGAELAHKTWRDLLGNRQDEVTTDDQGNATF
PVNGGSVSVWVLAENL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaaccacgctgctgcaattttttcattggtattaccccgatgggggtaag
ctatggcaggaagccgcggaacgcgcaccgcacattgccggactgggcatcaccgatctg
tggctgccgcccgcctataagggggcttccggcggttattcggtaggttacgacagttat
gatctgttcgatctgggcgagttcgatcaaaaaggcagccgcgccaccaaatacggcgat
aaagaggcactgacccatgccgccgctacgctgcgcgacaacggcgtgcgagtgatttat
gacgtggtgttcaaccacaagctcggcgccgacgagaaagaacaggtccgcgtgtaccgg
gcggacgtcaacaaccgcaataatatcaacgatcagggcttcgacgcgctggcttatacg
cgttttactttccccggccgccagggcacctattccaaatttatttgggattataaatgt
tttggcggagtcgattacattgaacagccggatgaaaaaggcgtgttcaaaatcgacaat
gactacggcgacgacggctggaacgatcaggtcggcgacgagaaaggcaattacgattat
ctgatgggcgccgacgtggagtttcgcaacacggcggtggcggaagagctgaagttctgg
gcgcgctggctgatggaaagcctgccgtgcgacggattccggctggatgccgccaaacac
attccagcctggttctttaaggagtgggcggaccatgtgcgcgacgccgcacagcgcgac
ctgtttatcgtcgcggaatactggtcacacgatttggcggcgttacggcagtatattgac
ctggtggacggcaaagtgatgctgttcgacgtggcgttgcacctgaagtttcatcaggcc
tcgaagcagggcgacggattcgacatgacgcagatttttaccgacaccctgactgccgcc
gatccggcacactcggtcacgctggtcgccaaccacgacactcagccgctgcagtcgctg
gaagccccggtcgagccttggtttaaaccgctggcctacgccctgatcctgctgcgcgaa
cagggtgtgccctgcgtgttttatcctgacctgtacggtgccagttataaagacaaaggc
ggcgacggcaatgaataccagattgatatgccggtgatccccgagctggaaaaattgatc
caggcgcgtcaacgctttgccaacggcgtgcaaaccgattattttaacgatagaaactgt
gtggccttcagccgcagcggcaccgctgatacccccggctgcgtagtggtgctcaccaat
ggcgccgaaaacggcaaagcggtttctctgggcgcggagttggcgcataaaacctggcgc
gacctgctcggcaaccgtcaggatgaagtcaccaccgacgatcaggggaacgccactttc
ccggtaaacggtggcagcgtcagcgtctgggtgctggccgaaaacctgtag

DBGET integrated database retrieval system