KEGG   Serratia plymuthica 4Rx13: SOD_c14070Help
Entry
SOD_c14070        CDS       T02710                                 

Gene name
phoA1
Definition
alkaline phosphatase PhoA (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SOD_c14070 (phoA1)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SOD_c14070 (phoA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SOD_c14070 (phoA1)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SOD_c14070 (phoA1)
Exosome [BR:srl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SOD_c14070 (phoA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1527779..1529206)
Genome map
AA seq 475 aa AA seqDB search
MLQPVSLIAGAVLSALLCSTALADETPANTAGLSERAARGNIVEPGGARRLSGDQTAALK
ASLSDKTVKNVILLIGDGMGDSEITSARNYAEGAGGYFKGIDALPLTGQYTHYSLDKKTH
KPDYVTDSAASATAWSTGVKTYNGALGVDVNGKDQPTLLEIAKAAGKATGNVSTAELQDA
TPAAQVSHVTSRKCYGPEETSEKCATNALENGGRGSITEQLLKTRADVSLGGGAKSFNQL
AKSGEWQGKSLKDQATALGYQWVENLDGLNAISVANQQKPLLGLFAAGNMPVRWQGPKAS
HHGNIDQPAVTCENNPARTADIPTLAAMTEKAIDLLKNQQNGFFLQVEGASIDKQDHEAN
PCGQFGETVDLDEAVQKALAFARADGNTLVIVTADHAHSSQIIAVDAKAPGLTQTLTTKD
GAPMTISYGNSEEGSQGHTGTQLRVAAYGPHAANVVGLTDQTDLFYTMRDAMAIK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcccgtttctttgatcgccggcgccgtgttatccgccctgctttgttccacc
gccctcgccgatgaaacgccggccaataccgcgggtctttccgagcgagcggcacgcggt
aacatcgtggaaccgggcggtgcacgccgtctgagcggcgatcaaaccgccgcgctgaaa
gcctcgctgtctgacaaaacggtcaaaaacgtgattttattgatcggcgacggcatgggc
gattctgaaatcacctcggcgcgcaactacgcagaaggcgcgggcggctattttaaaggc
attgatgccctgccgctgaccggccagtacacccattactcgctggataagaaaacccac
aaaccggattacgtgacggattccgccgcttcggcgaccgcatggtccaccggcgtaaaa
acctataacggcgcgctgggggttgacgtcaacggcaaggaccagccgacgctgctggag
atcgccaaggcggctggcaaagccaccggtaacgtctccaccgccgagctgcaggacgcc
acaccggccgcgcaggtctcgcatgttacctcgcgcaaatgttacggcccggaagaaacc
agcgaaaaatgcgccaccaacgcgctggagaatggcggccgcggctcgatcaccgagcaa
ttgctcaaaacccgtgccgacgtctcgctgggcggtggagcgaaatcctttaatcagctg
gcgaaaagcggcgaatggcagggaaaatcattgaaagaccaggcaactgcgctgggttat
cagtgggtggaaaacctcgacggcctgaatgccatcagcgtagccaatcagcaaaaaccg
ctgctgggattgtttgccgccggcaatatgccggtgcgctggcagggcccgaaagcttcg
catcacggtaatatcgaccaaccggcggtcacctgcgagaacaacccggcacgtactgcc
gatattccaacgctggcggcgatgaccgaaaaagcgatagatctgttgaaaaaccagcag
aacggtttcttcttgcaggtggaaggcgcatcgatcgacaagcaggaccatgaagccaac
ccttgcggccagttcggcgagacggtcgatctggatgaagcggtacagaaagcgctggcc
ttcgcccgcgccgacggcaacaccctggtgatcgtcaccgccgaccacgcccactccagc
cagattattgccgtcgatgccaaggctccaggcctgacgcaaacgctgaccaccaaagat
ggcgcgccaatgaccatcagctacggtaactcggaggaaggctctcagggacacaccggc
acccagttgcgcgttgccgcctacggcccgcatgcggctaacgtcgtgggcctgaccgat
cagaccgacctgttctacaccatgcgtgacgctatggcgatcaagtaa

DBGET integrated database retrieval system