KEGG   Serratia plymuthica 4Rx13: SOD_c25450Help
Entry
SOD_c25450        CDS       T02710                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase AdhE
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00010  Glycolysis / Gluconeogenesis
srl00071  Fatty acid degradation
srl00350  Tyrosine metabolism
srl00620  Pyruvate metabolism
srl00625  Chloroalkane and chloroalkene degradation
srl00626  Naphthalene degradation
srl00650  Butanoate metabolism
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
srl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c25450 (adhE)
   00620 Pyruvate metabolism
    SOD_c25450 (adhE)
   00650 Butanoate metabolism
    SOD_c25450 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SOD_c25450 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SOD_c25450 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SOD_c25450 (adhE)
   00626 Naphthalene degradation
    SOD_c25450 (adhE)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SOD_c25450 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SOD_c25450 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Peripla_BP_6 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AGO55519
UniProt: S0AHY8
Position
2858587..2861106
Genome map
AA seq 839 aa AA seqDB search
MAVEESGMGIVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPIGLICGIV
PTTNPTSTAIFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIVGWID
QPTVELSNQLMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVV
ASILMSKTFDSGVICASEQSVIVVDSVYDAVRERFSSHGGYLLQGKELKAVQDIILKNGG
LNAAIVGQSAPKIAEMAGIKVPASTKVLIGEVKLVDESEPFAHEKLSPTLAMYRAKDFED
AVSKAEKLVAMGGIGHTSCLYTDQDNQPERVAFFGDKMKTARILINTPASQGGIGDLYNF
KLAPSLTLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAL
EEVATDGAKRAFIVTDRYLFNNGYADQITTVLKSHGIETEVFFEVEADPTLSIVRKGAEQ
MNSFKPDVIIALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAK
MIAVTTTSGTGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGG
LDAVTHALEAYVSVLANEYSDGQALQALKLLKEYLPASYKEGAKNPVARERVHNAATIAG
IAFANAFLGVCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQA
RRRYAEIADHLGLSAPGDRTAQKIEKLLVWLDEIKTELGIPASIREAGVQEADFLAKVDK
LSEDAFDDQCTGANPRYPLIAELKQIMLDTFYGRKFSEADEEEVVVAPVAAKAEKKSKK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaagaatccggtatgggtatcgttgaagataaagtgatcaaaaaccacttc
gcttcagagtatatctacaacgcgtataaagatgaaaaaacctgcggtatcctgtctgaa
gacgatacttttggcacgatcaccatcgccgagcctattggcttgatttgcggtatcgta
ccgaccaccaacccaacctctacggctatttttaaagcgctgatcagcctgaaaacccgt
aacggcattatcttctcgccacatccgcgtgcgaaaaacgccaccaacaaagcggcggat
atcgtgttgcaggcggccatcgctgccggggcaccaaaagacatcgtcggctggattgac
cagcctaccgttgaactgtccaaccagttaatgcaccacccggacatcaacctgatcctc
gctactggcggcccaggtatggtgaaagccgcctacagctccggcaagcctgcaatcggt
gttggtgccggtaacactccggtggtggttgacgagacagcggacatcaaacgcgttgtt
gcctctattttgatgtctaaaaccttcgacagcggcgtgatttgcgcctccgagcagtct
gtcatcgtcgttgactccgtctatgatgcagtgcgtgagcgtttctcttcccacggtggc
tacctgctgcagggcaaagagctgaaagcggtccaggacatcattctgaaaaacggcggc
ctgaacgcggccatcgtcggccaatctgcgccgaaaatcgctgaaatggccggcatcaaa
gtgccagccagcaccaaggtactgatcggtgaagtgaaattggttgatgaatccgaacct
ttcgctcacgaaaaactgtctccgacgctggcaatgtatcgcgccaaagattttgaagac
gccgtcagcaaagcggaaaaactggtcgccatgggcggtatcggccatacgtcctgcttg
tacaccgaccaggataaccaaccggaacgcgttgccttcttcggcgacaagatgaaaacc
gcacgtatcctgatcaacaccccggcgtctcagggtggtatcggtgacctgtacaacttt
aaactcgctccgtcactgacgctgggctgcggttcctggggtggtaactccatctctgaa
aacgtcggtccaaaacacttgatcaacaagaaaactgtagcgaagcgagcagaaaacatg
ttgtggcataaacttccgaaatcaatctacttccgccgtggctcattgcctatcgcgctg
gaagaagtagcgaccgacggggcaaaacgcgccttcattgtgaccgaccgctacctgttc
aacaacggctacgcagaccagatcaccacggttctgaaatcgcacggcattgaaacagaa
gtgttctttgaggtagaagcggacccaacgctgtccatcgtgcgtaaaggcgccgaacag
atgaactccttcaaaccagacgtgatcatcgcgctgggtggcggttcaccgatggatgct
gcgaagatcatgtgggtgttgtacgagcatccggaaacccatttcgaagacctggcgctg
cgctttatggatatccgtaaacgtatctacaagttcccgaaaatgggcgtcaaagcaaaa
atgattgccgtcaccactacctcaggtaccggttctgaagtcacgccgtttgcggtagtg
accgacgatgcgaccggccagaaatacccgctggctgactacgcattgacgccggatatg
gcgatcgttgacgccaatctggtgatgaacatgccgaaatccctctgtgccttcggcggc
ctggatgcggttacccacgcactggaagcttatgtatcggtactggcgaacgaatactct
gacggccaagcgctgcaagccctgaaattgctgaaagaatatctgccagccagctacaag
gaaggcgccaaaaacccggtagcccgtgagcgtgtgcacaacgccgcgaccattgccggt
atcgcgtttgccaacgccttcctgggggtttgccactccatggcccacaaactgggctct
gagttccatatcccgcacggcctggccaacgccatgttgatctccaacgtcattcgctat
aacgcgaacgacaatccgaccaagcagacggccttcagccagtacgaccgcccacaggca
cgtcgtcgctacgctgaaatcgccgaccacctcggcctgagcgcaccgggcgaccgtacc
gcgcaaaaaatcgagaagctgctggtatggctggatgagatcaaaaccgagctgggcatc
cctgcttccatccgtgaagccggcgtgcaggaagccgacttcctggcgaaagtcgacaaa
ctgtccgaagacgcctttgacgaccaatgtaccggcgccaacccgcgttatccgctgatt
gccgaactgaagcaaatcatgctggataccttctacggacgtaagttcagcgaagcggac
gaggaagaagttgtggttgcaccggttgcggccaaagcggaaaaaaagtccaaaaaataa

DBGET integrated database retrieval system