KEGG   Serratia plymuthica 4Rx13: SOD_c25460Help
Entry
SOD_c25460        CDS       T02710                                 

Gene name
tdk
Definition
thymidine kinase Tdk (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:srl00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2861231..2861815)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDSMLYAMIAQEHQQQPVHCVLLDESQFLTKAQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDESGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIHALE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattattctgctatgaatgcaggaaaatccaccgcgctgtta
caatcttcatataattatcaagaacgtggtatgcgcacgttggtgtttactgccgaaatc
gatcatcgttttggcgtagggaaggtgagttcgcgcatcggattgtcgtctcaggcgcag
ctctataataatgactccatgctctatgccatgattgctcaggaacatcagcagcagccg
gtacactgcgtgttattggatgaaagccaattcttgacgaaagcacaggttgagcaattg
tgcgacgtagtcgaccaactggatattccggtgttgtgctatgggttgcgcaccgacttt
ctgggtgagctgtttatcggcagccaatatttgctggcttgggcggataaactggtggag
ttgaaaaccatctgtcactgcggccgcaaggcgaatatggttctgaggctggatgaaagc
ggccaggcaatgcatgcaggtgaacaggtcgtgataggcggtaacgagagctacgtgtcc
gtttgccgcaaacattataaggaagccatacacgcactggagtaa

DBGET integrated database retrieval system