KEGG   Serratia plymuthica 4Rx13: SOD_c31940Help
Entry
SOD_c31940        CDS       T02710                                 

Gene name
katA
Definition
catalase KatA (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SOD_c31940 (katA)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SOD_c31940 (katA)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SOD_c31940 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3585103..3586539
Genome map
AA seq 478 aa AA seqDB search
MSKKGLTTAAGAPVVDNNNVITAGKRGPMLLQDVWFLEKLAHFDREVIPERRMHAKGSGA
YGTFTVTHDITRYTRAKIFAEIGKQTDMFIRFSTVAGERGAADAERDIRGFAMKFYTDEG
NWDLVGNDTPVFYLRDPLKFPDLNHVVKRDPHTNLRNPVYKWDFFSHLPESLHQLTIDFS
DRGIPKSYRHMHGFGSHTFSFINANNERFWVKFHFRCEQGIENLMDDEAEAIIAKDRESS
QRDLFDAIKRGDFPRWKLQIQIMPEHEASQTPYNPFDLTKVWPHGDYPLIDVGFFELNRN
PDNYFSEVEQVAMNPANVVPGVSFSPDKMLQGRLFSYGDAHRYRLGVNHHQIPVNGAKCP
FHNYHRDGAMRVDGNSGNGATYEPNSFGLFQEQPDFSEPPLSIEGAADHWNHREDKDYFS
QPRALFNLLSAEEHQRMFTRIAGELSQVPEQIQRRQVDLFTQVHPDYGAGVASALGLK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaggattgaccaccgcagccggtgccccggttgtcgataacaataatgtg
atcaccgcaggaaaacgcgggccgatgctgctgcaggacgtctggttcctggaaaaactg
gcccatttcgaccgcgaagtgatccccgagcgccgcatgcacgccaaaggttccggcgcc
tacggcactttcaccgtcacccatgatattacccgatacacccgcgcaaaaatcttcgct
gaaatcggcaagcaaaccgacatgttcatccgcttctccaccgtagccggtgaacgcggc
gcagcagacgccgagcgcgacattcgcggttttgccatgaaattttacaccgatgaaggc
aactgggatctggtaggcaacgacacgccggttttctatctgcgcgatccgctgaagttt
cccgatcttaaccacgtagtaaaacgcgatccgcacaccaacctgcgcaacccggtgtac
aaatgggatttcttctcccatctgccggaatctttgcaccaattgaccatcgatttcagc
gatcgcggtatcccgaaatcctatcgccacatgcatggtttcggcagccacaccttcagc
tttatcaatgccaataacgagcgtttctgggtgaaattccacttccgctgcgaacagggc
attgaaaacctgatggatgacgaagcggaagcaatcatcgccaaagatcgcgaaagctcg
cagcgcgacctgttcgacgcaatcaagcgcggtgatttcccgcgatggaagctgcaaatt
caaatcatgcctgaacacgaagcctcgcagacgccctacaacccgttcgatctgaccaaa
gtatggccgcatggcgactacccgctgatcgacgtcggcttcttcgaactgaaccgcaac
ccggacaactatttctcagaagtcgaacaggtggcgatgaacccggccaacgtggttccg
ggcgtcagcttctcgccggacaaaatgctgcaaggccgcctgttctcttacggggatgcg
caccgttaccgcctgggcgttaaccatcaccaaatcccggttaacggcgccaaatgcccg
ttccacaactatcaccgcgacggcgcgatgcgcgtggacggcaacagcggcaacggggcg
acctacgaaccgaacagcttcggcctgttccaggagcaaccggacttcagcgaaccgccg
ttgagcatcgaaggtgctgccgatcactggaatcaccgcgaggataaggattatttcagc
cagccacgcgcgctgttcaacctgctgagtgccgaagaacaccagcgtatgttcacccgt
atcgccggtgaactgtcgcaagtgccggaacagatccaacgccgtcaggtcgatctgttt
acccaggtgcacccggactacggcgccggcgtcgccagtgcgcttggcttgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system