KEGG   Serratia plymuthica 4Rx13: SOD_c44300Help
Entry
SOD_c44300        CDS       T02710                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.26)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SOD_c44300 (malQ)
Enzymes [BR:srl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SOD_c44300 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4973852..4975942)
Genome map
AA seq 696 aa AA seqDB search
MDRKRIDQAAAQAGIAADYINAHGKQQAIAQDTKRKLLDAMGRTAAPLEAAVTPLPAVKV
FYQGAPVALPLAGSGEYLWTLLREDGGRQQGRAGARKTLTLPGELPAGYHQLTLTQDEQQ
WQCRLIVAPKRCFEPDALLTGQKLWGACVQLYTLRSDRNWGIGDFGDLRQMVEQVGERGG
AFVGLNPIHALYPANPESASPYSPSSRRWLNVVYIDVNAVEEFQRSDAAQKWWLKPATQK
QLIKARSSELVDYSTVTQLKLAALKLAFPLFQGRKAGDEQRQAFEQFVADGGDSLYQQAA
FDALHAHLAAADGSLWGWPAWPEQYRQGDSAAVKQFCRQQQDSVTFYLWLQWLAASQFAD
CFRRSQQQQMPIGLYRDLAVGVAEGGSETWCEPDLYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMAARGYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGETADHGAYVKYPVDD
LLAVLALESQRHRCMVIGEDLGTVPVEIVAKLRDSGVYSYKVLYFERDGENHFRAPQAYP
VQAMATITTHDLPTLRGYWQSGDLQLGNQLGLYPDAEILKELFADRERAKQGLLDGLHHY
GCVPQKVGKKAALLNMSPLLNRGLQRYVADSASALLGLQPEDWLDMAEPVNIPGTSDQYP
NWRRKLNKTLEEMFTDQQVNRLLKDLDKRRRTVSVG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcaagcgcatcgatcaggcggccgctcaggcgggtattgccgctgattatatt
aacgctcatgggaaacagcaggcgatcgcgcaggacaccaagcgcaaactgctggatgcc
atggggcggactgccgcgccgctggaggctgcggtgacgccgctgccggcggtcaaggta
ttctatcagggcgcgccggtggcgttgccgcttgcgggcagcggcgagtatctctggact
ctgctgcgtgaagacggtggccggcaacaggggcgcgccggcgcgcgtaaaacccttacc
ctgccgggcgagttgccggcgggttatcaccaactgacgctaacccaggacgaacagcag
tggcagtgccggttgattgttgcgccgaaacgctgctttgagccggatgcgctgctgacc
ggacaaaaactgtggggcgcttgcgtccagctttacaccctgcgctccgatcgtaactgg
ggtatcggcgatttcggcgatctgcggcagatggtggagcaggtcggggaacggggcggc
gcttttgtcgggctgaacccgatccacgcgctgtatccggcgaacccggaaagcgccagc
ccgtacagcccgtcgtcgcgacgctggctgaacgtggtgtatatcgatgtgaacgcggtg
gaagagttccagcgtagcgatgcggcgcagaaatggtggctgaagccggcaacgcaaaaa
cagctgatcaaagcgcgcagcagcgaactggtggattacagcacggtgacgcagctcaag
ctggcggcgctgaagctggcgttcccgttgttccaggggcgtaaagctggtgacgaacag
cgtcaggcgttcgagcagtttgttgccgacggtggcgacagcctgtatcaacaggcggcg
tttgacgcattgcatgctcatcttgccgccgctgacggcagcctgtggggttggccggcc
tggcctgagcaatatcggcagggcgacagcgccgcagttaagcagttttgccggcaacag
caagattcggtgaccttctatctgtggttgcagtggttggccgccagccagttcgccgac
tgtttccgccggagccagcaacagcaaatgccgattggcctgtaccgcgatttagcggta
ggcgtggcggagggcggttcggaaacctggtgcgagccggatctttattgcctgaaagcg
tcggttggcgcgccgccggacattctgggcccgctggggcaaaactgggggctgccgccg
atggatccgcatgtgatggcggcgcggggttaccagccgtttatcgatctgttgcgcgcc
aatatgaccagttgcggtgcgctgcgcattgaccacgtaatggcgttgctgcgcctgtgg
tggatcccctacggtgaaaccgccgatcatggcgcttacgtgaaatacccggtggatgac
ctgttggcggtgttggcgctggagagccagcgtcaccgctgtatggtgattggcgaagac
ctcgggaccgtgccggtcgagattgtcgccaagctgcgcgacagcggcgtctattcttat
aaggtgctgtatttcgagcgtgacggcgagaaccacttccgtgcgccgcaggcctacccg
gtgcaggcgatggcgaccatcaccacgcatgacctgccgacgctgcgcggttattggcag
agcggcgatctgcaactgggcaaccagctggggctgtatccggatgcggagatcctgaaa
gaattgtttgccgatcgtgagcgcgccaagcaggggttgctggacggattgcatcattat
ggctgcgtgccgcagaaggtgggcaagaaggcggcgttgctgaacatgagcccgctgctc
aaccgtggcttgcagcgctatgttgccgacagtgccagcgcactgctgggcctgcagccg
gaagactggctggacatggccgaaccggtcaatattcccggcaccagcgatcagtaccca
aactggcggcgtaaactgaacaaaaccctcgaggagatgtttaccgatcagcaggttaac
cggttgctgaaggatctggacaagcggcggcgaacggtgtcggtggggtaa

DBGET integrated database retrieval system