KEGG   Serratia plymuthica 4Rx13: SOD_c45870Help
Entry
SOD_c45870        CDS       T02710                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase ArgH
  KO
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SOD_c45870 (argH)
   00220 Arginine biosynthesis
    SOD_c45870 (argH)
Enzymes [BR:srl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     SOD_c45870 (argH)
Exosome [BR:srl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SOD_c45870 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5158925..5160298)
Genome map
AA seq 457 aa AA seqDB search
MALWGGRFSQAADQRFKQLNDSLRFDYRLAEQDIVGSVAWSKALVTVNVLTATEQQQLEQ
ALSVLLEEVQADPQAIVSSDAEDIHSWVEQKLIDKVGDLGKKLHTGRSRNDQVATDLKLW
CKQQIGELHQAIVQLQQALVETAEANQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDTLKRLDVSPLGSGALAGTAYPIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
NASISMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWMDCLQMAALVLDGIQVKRPRCKEAA
EQGYANSTELADYLVAKGVPFREAHHIVGEAVVEAIQQGKALEALTLTELQKFSAVIGDD
VYPILALQSCLDKRSAKGGVSPQQVASAIAEAKQRLF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggggcggacggttcagtcaggcggcagatcagcggttcaaacagttaaac
gactctctgcgctttgattatcgcctggcggaacaggacattgttggctctgtggcctgg
tcgaaagcgctggtcaccgtcaacgtgctgacggcaaccgagcagcaacagcttgagcag
gctttgagcgtgttgttggaagaggtgcaggccgacccgcaggcgattgtcagcagcgat
gcggaagatattcacagctgggtggagcagaagctgatcgataaagtcggcgatctgggc
aagaagctgcataccggccgtagccgtaacgatcaggtcgcgaccgatctgaaactgtgg
tgcaaacagcaaatcggcgaactgcatcaggccatagtgcaactgcagcaggcgctggtg
gaaactgccgaagccaatcaggatgcggtgatgccgggttatacccacctgcagcgcgcg
caaccggtcactttcgctcactggtgcctggcctatgtggaaatgctggcgcgcgatgaa
agccgcctgcaagatacgctcaagcgcctggacgtcagcccgctgggcagcggcgcgcta
gccggtaccgcttatccgatcgatcgtgaacagcttgccggttggttgggctttgcctcg
gccacccgcaatagcctggacagcgtttccgaccgcgaccacgtgctggagctgctgtcg
aatgcctccatcagcatggtgcatctgtcgcgctttgccgaagacctgatcttcttcaac
agcggcgaagcggcgtttgtcgacttgtctgaccgcgtaacctccggctcttcgttgatg
ccgcagaagaaaaacccggatgcgttggaactgatccgcggcaaatgcggccgtgtacag
ggcgcattgaccggcatgatgatgacgctgaaaggcttgccgctggcgtataacaaagac
atgcaggaagacaaggaagggctgttcgacgcactggatacctggatggattgcctgcag
atggcggcgctggtgctggacggcattcaggtgaaacgcccacgctgcaaagaggcggct
gagcagggttacgccaactcgaccgaactggcggactatctggtcgccaaaggcgtgccg
ttccgtgaggcgcaccatatcgtcggtgaagcggtggtagaagccatccaacagggcaag
gcgcttgaggcgctgacgctgaccgaattgcagaagttcagtgcggtgattggcgacgac
gtgtacccgatcctggcgctgcaatcttgcctggataagcgttcggccaagggcggcgtt
tctcctcagcaggtcgccagcgcgatcgccgaagcgaaacagcggttgttttaa

DBGET integrated database retrieval system