KEGG   Serratia plymuthica 4Rx13: SOD_c45940Help
Entry
SOD_c45940        CDS       T02710                                 

Gene name
lysE4
Definition
(GenBank) lysine exporter protein LysE/YggA
  KO
K06895  
L-lysine exporter family protein LysE/ArgO
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transporters [BR:srl02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SOD_c45940 (lysE4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5168670..5169302)
Genome map
AA seq 210 aa AA seqDB search
MMPFSNGFLLSLSLCLDIGIANIAMITLAMQRGYFHGFWLGIGTCVGDLIYAVLALAGMA
VLLQYQGVRWVLWIGGSMMLLWFAYKMLRAAFARATELAVAEPETPRSVPRNFLRGVVLA
MSSPTAILWFAAVGGALISRMGQGGPAATSWFLSGFFIAGVVWTAVLCSVGSLGGKMLGA
RLLKYSYFASAVIFGYFALYVVVSGYREFI
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgttttccaatggttttttactcagtttgtcgctttgtctggatattggcatc
gccaatatcgccatgatcacgctggcgatgcaacgcggctattttcacggcttctggctg
gggatcggtacctgcgtgggtgacctgatttatgcggtgctggcgctggcgggcatggcg
gtgctgttgcaataccaaggtgtccgctgggtactgtggatcggcggctcaatgatgctg
ctgtggttcgcttacaaaatgctgcgggcggccttcgccagggcgactgagctggcagtg
gctgaaccggagacgccacgctcggtgccgcgcaactttctgcgcggcgtagtgctggcg
atgtcatctcctacggcgatcctgtggtttgcggcggtgggcggcgcgctgatttcacgt
atgggtcagggggggccggcggcaacgtcgtggttcctctccggcttttttattgccggc
gtggtgtggacggcggtgctttgttccgttggcagcctgggtggcaaaatgctgggggca
cgcctgctgaaatattcttactttgcttcggcggtgatttttggctacttcgcgctgtac
gtggtggtgtcgggctaccgtgagtttatttag

DBGET integrated database retrieval system