KEGG   Serratia plymuthica 4Rx13: SOD_c45960Help
Entry
SOD_c45960        CDS       T02710                                 

Gene name
metL
Definition
(GenBank) bifunctional aspartokinase/homoserine dehydrogenase 2
  KO
K12525  
bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOD_c45960 (metL)
   00270 Cysteine and methionine metabolism
    SOD_c45960 (metL)
   00300 Lysine biosynthesis
    SOD_c45960 (metL)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SOD_c45960 (metL)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     SOD_c45960 (metL)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     SOD_c45960 (metL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5170558..5172993)
Genome map
AA seq 811 aa AA seqDB search
MNAIAVAGPVSGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPGDMMVVSAAGSTTNQLIN
WLKLSQSDRLSAHQVQQTLRRYHSELIGGLLPPETAEPLIAEFIQDLERLAVLLDDKIDD
VTYAEVVGHGEIWSARLMAAVLNKLDMQAAWLDARDFLRTERSAQPQVDEGRSYPLLQQL
LAQHPGKRLVVTGFISRNDAGETVLLGRNGSDYSATQVGALAGVERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGTGAKIVTSHDDVCLIELRVASQHDFKLAQKDLDLVLKRAQIKPLAVGIHPDRNL
VQLCYTSEVVNSVLRTLQDAGLPGELKLREGLALVALVGAGVCKNPLHSHRFYQQLKDQP
VEFIWQAEDGISLVAVLRQGPTALLIQGLHQSLFRAEKRIGLVLFGKGNIGARWLELFAR
EQKNISARSGFEFTLAGVVDSRRSLLDYDGLDASRALAFFEDEAQELDEESLFLWMRAHP
FDDLVVLDVTASENLAEQYLDFASYGFHVISANKLAGASCGDNYRQIRDAFAKTGRHWLY
NATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTLSWLFLQFDGTVPFTELVDQAWQQGL
TEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQVRVESLVPAGAEQGSVDQFFENGDALN
QQMLQRFEAASEMGLVLRHVARFDANGKARVGVEAVRPEHPLAALLPCDNVFAIESRWYR
DNPLVIRGPGAGRDVTAGAIQSDLNRLAQLL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaattgcggtagcagggccggtgagcgggcgtcaactgcacaagtttggcggc
agcagcctggcggacgtgaagtgttatctgcgtgtggccgggatcatggccgaatacagc
cagccgggcgatatgatggtggtgtcggctgccggcagcaccaccaaccaactgattaac
tggctgaagctcagccagagcgatcgcctttctgcgcatcaggttcagcagacgctgcgc
cgttatcacagcgaattgatcggcggtttattgccgccggaaaccgccgaaccgctgatc
gccgaatttattcaggatctggagcgtctggcagttttgctggatgacaagattgacgac
gtgacttatgccgaggtcgtcggccacggcgaaatctggtcggcgcggctgatggctgcg
gtactgaacaagttggatatgcaggcggcctggctggatgcgcgcgattttctgcgtacg
gaacgctctgctcagccgcaggttgatgaaggccgttcttacccgctgctgcaacaattg
ctggctcagcacccaggcaaacgcctggtggtgaccggttttatttcacgcaacgacgcc
ggtgaaaccgtgctgttggggcgtaacggcagtgactattccgcgacccaggtcggcgct
ttggccggcgtggagcgcgtgactatctggagcgacgtggccggggtgtacagcgccgac
ccacgtaaagtgaaagatgcctgcctgctgccgctgctgcggttggatgaagccagcgaa
ctggcgcgtctggcggcaccggtgctgcatacccgcaccttgcagccggtttccggcagc
gatatcgatctccagctgcgatgcagttaccagccggaacagggttcaacgcgcatcgaa
cgcgtgctggcttccggcacgggcgcgaagattgtcaccagccatgatgacgtgtgcctg
attgagctgcgcgtcgccagccagcatgatttcaagctggcgcagaaagatctggatctg
gtgctgaagcgcgcgcagatcaaacccttggccgtcggcattcatccggaccgcaacctg
gttcagctgtgctacacctcggaagtggtgaacagcgtgctgcgtaccttgcaggatgcc
gggttgccgggggaactgaagctgcgcgaagggctggcgctggtggcgctggtgggggcg
ggggtttgcaaaaacccgctgcacagccatcgtttctaccaacagttgaaagaccagccg
gttgagtttatctggcaggcggaagacggcatcagcctggtggcggtactgcgtcagggg
ccgactgccttgctgattcagggcttgcaccagtcattgttccgcgctgaaaaacgcatc
ggtctggtgctgttcggcaaaggcaacattggcgcacgctggctggaactgtttgcccgc
gagcagaaaaatatttccgcccgcagcggttttgaattcactctggccggggtggtggac
agccgccgcagcctgctggattacgacgggctggacgccagccgcgcgctggcattcttc
gaggacgaagcgcaggagctggacgaagagtctctgttcctgtggatgcgtgcgcacccg
ttcgacgatctggtggtgcttgacgttaccgccagtgaaaatctggccgagcagtatctg
gacttcgccagctacggttttcacgtgattagcgccaacaagctggcgggcgcgtcgtgc
ggtgataactaccgccaaatccgcgatgccttcgccaaaaccggtcgtcactggctgtat
aacgccaccgtcggtgccggtctgccggtcaatcatacggtgcgcgatctgcgcgacagc
ggcgacagcattttggcgatcagcggtatcttctccggtacgctttcctggttgttcctg
cagttcgacggcacggtgccgttcaccgaactggtggatcaggcctggcagcaggggctg
acggaaccggatccgcgcgtcgatctctccggccaggacgtaatgcgcaagctggtcatt
ctggcgcgcgaagcgggctatgacatcgaaccgaatcaggtgcgggtagagtcgctggtg
cctgccggtgccgagcagggttctgtcgatcagttcttcgagaacggcgatgcgctgaac
caacagatgctgcagcgttttgaggctgccagcgaaatggggctggtgctgcggcacgtg
gcgcgcttcgatgccaacggcaaggcgcgtgtcggggtagaggcggtgcgtcctgagcac
ccgctggcggcgctgttgccgtgcgacaacgtgtttgctatcgaaagccgctggtaccgc
gataatccgttggtgatccgcgggccgggtgccggccgcgacgtcacggccggggcgatc
cagtcagaccttaaccgtttggcgcaactgctttaa

DBGET integrated database retrieval system