KEGG   Serratia plymuthica 4Rx13: SOD_c45970Help
Entry
SOD_c45970        CDS       T02710                                 

Gene name
metB
Definition
(GenBank) cystathionine gamma-synthase MetB
  KO
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SOD_c45970 (metB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SOD_c45970 (metB)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SOD_c45970 (metB)
Enzymes [BR:srl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     SOD_c45970 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5172996..5174156)
Genome map
AA seq 386 aa AA seqDB search
MTRKPATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTDFNQPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVMTSSGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVL
FVDQSNEEALAQALAQKPKLVLIESPSNPLLRVVDIAAICEAAHAAGALTVVDNTFLSPA
LQQPIGLGADLVVHSCTKYLNGHSDVVAGAVIAKDKDLAVELAWWANNIGVTGGAFDSYL
LLRGMRTLSPRIKAAQQNAEAIVSYLQQQPLVKKLYHPSLPQNPGHEIARRQQRGFGAML
SFELDGDEALLRRFLSALELFTLAESLGGVESLISHAATMTHAGMAAEARAAAGISESLL
RISVGIEDSEDLIADLERAFQAAATR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaaccagccacgattgccgtacgtagcggcctgaacgatgacgaacagtac
ggctgcgttgtcccgccgatccatctttccagcacctataatttcaccgatttcaaccag
cctcgcgctcatgactactcgcgccgcggcaatccgacgcgcgatgtggtgcaacgtgcg
ctggcggagctggaaggcggcgccggtgcggtaatgaccagtagcggaatgtcggcgatc
catctggtgaccaccgtgttcctgaaacccggcgatctgctggtggcgccgcacgattgc
tacggtggcagctaccgtcttttcgacagcctgagcaagcgaggcgcttaccgtgtgctg
tttgtcgatcagagtaatgaagaggcgttggcgcaggcgttggcgcaaaagccaaaactg
gtgctgatagaaagcccgagcaacccgcttttgcgcgtggtggacattgcggcgatttgc
gaggcggcgcatgcggcaggcgcgctgacggtagtggataacaccttcctcagcccggcg
ctgcagcagccgattggactgggagccgatctggtggttcactcctgcaccaaatacctc
aacggccattccgatgtggtggccggcgcggtgatcgccaaagataaagatctggcggtg
gagctggcttggtgggccaataatatcggcgttaccggcggcgcgttcgacagctatttg
ctgttgcgcggcatgcgtaccctgtcgccacgcatcaaggcggcgcaacaaaacgccgaa
gcgattgtcagttatttacagcagcaaccgctggtgaaaaagctgtatcatccttctctg
ccacagaacccagggcacgagattgcgcgccgccagcaacgcggctttggcgcgatgctc
agttttgaactggatggtgatgaggcgcttcttcgccgtttcctctctgcccttgagctg
tttactctggcagaatccttagggggcgtagaaagcctgatttcgcatgcagcgaccatg
acccatgccggtatggcagcggaagcacgtgcggcggccggtatctccgagagcctgctg
cgtatttccgtgggtattgaagacagcgaagatttgattgccgatctggaacgtgctttc
caggcggcggcaacgaggtaa

DBGET integrated database retrieval system