KEGG   Serratia plymuthica 4Rx13: SOD_c46000Help
Entry
SOD_c46000        CDS       T02710                                 

Gene name
priA
Definition
(GenBank) primosomal protein N'
  KO
K04066  
primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:srl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SOD_c46000 (priA)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SOD_c46000 (priA)
DNA repair and recombination proteins [BR:srl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SOD_c46000 (priA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5175286..5177481
Genome map
AA seq 731 aa AA seqDB search
MPVVHVALPVPLARTFDYLLPQGLQPVAGARVCVPWGKQRAIGIVTGSSDTSELPLDKLK
PIDSIIDNASLFSPSLWRILRWASDYYHYPIGEVLFHALPILLRQGKPAEAAPLWQWFAT
EQGRATPPESLKRAPKQQQALAALLQRPVYRHQVSELELTESALQALRAKGLIDLRAQTL
ATQDWRPGFEVLGERLRLNTEQATAVGAIRSEDNQFAAWLLAGVTGSGKTEVYLSVLENI
LAMGKQALVLVPEIGLTPQTIARFRERFNAPVDVLHSGLNDSERLAVWLRARSGEAAIVI
GTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDLAVFRAREENIPMVMGSATPAL
ETLHNVQLGKYRQLKLTQRAGNAKPATQHLIDLKGLPLKVGLSQPLLKSMQHHLKAGNQV
MLFLNRRGYAPALLCHECGWIAECQRCDHYYTFHQNHRQLRCHHCDSQRPVPHQCPQCGS
THLVSVGVGTEQLENELAPLFPETPITRIDRDTTSRKGSLEQHLADIHRGGSRILIGTQM
LAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVLLQTHHP
EHPLLQILLQQGYEAFSKQTLAERNSVFLPPYTSHIIVRSEDHDNQQAPLFLQQLRNLLE
ASPLKDDSLWVMGPVPALQSKRGGRFRWQLLLQHPSRRVLQQLMKSSLPLIGTLPQARKV
KWTLDVDPIDS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgtacacgttgctttaccggttcccctcgcccgcaccttcgactatctgctg
ccgcaaggcctgcagccggtagccggcgcgcgcgtttgcgtaccctggggtaagcaacgg
gcaatcggcatcgtcaccggcagcagcgacaccagcgaactgccgctggataagctcaag
cccatcgacagcatcatcgacaacgcctccctgttctcccccagcctgtggcgcattctt
cgctgggccagcgactattatcattatcctatcggcgaagtgctgttccacgcgctgccg
atcctgctgaggcaaggcaaaccggctgaagccgcgccgctgtggcaatggttcgccact
gaacagggccgcgccacgccgccggaaagcctgaaacgcgcccccaaacaacagcaggca
ctggccgcgctgctgcaacgcccggtgtatcgccaccaggtcagcgaacttgaactgacc
gagagcgcgctgcaggcattgcgcgccaaagggctgatcgacttacgggctcagactttg
gcgacgcaggactggcgaccgggttttgaagtgctcggcgaacggctgcggctgaatacc
gagcaggccaccgccgtgggtgcgatccgcagcgaagacaatcagtttgccgcctggctg
ctggccggggtcaccggctccggcaagacagaagtctatctcagcgtgctggaaaacatt
ctggccatgggcaagcaggcgctggtgctggtgccggaaatcggcctgacaccgcaaacc
atcgcccgctttcgcgagcgcttcaatgcgccggtagacgtactgcactccggcctcaac
gacagcgaacggctggcggtatggctgcgcgcccgcagcggtgaagcggcgattgtcata
ggcacccgctctgcgctatttaccccgttctcacgcctgggcgtgatcattatcgacgaa
gagcacgacagctcctataaacagcaggaaggctggcgctaccacgcacgcgatctggcg
gtgttccgcgcccgggaagagaacatcccgatggtcatgggttccgccacgccggcgctg
gaaacgctgcacaacgtgcaactgggtaaataccgtcaactcaagctcacccagcgcgcg
ggcaacgccaaaccggcgacgcagcatctgatcgacctgaaaggcctgccgctgaaggtg
ggtctgtcgcagcctttgctgaaaagcatgcagcaccacctgaaagccggcaatcaggtg
atgttattccttaaccgccgcggctatgcgccggcgttgttgtgccacgagtgcggctgg
attgccgaatgccaacgctgcgatcattactacaccttccatcagaaccatcgccaactg
cgctgccaccactgcgacagccagcggccggtaccgcaccagtgtccgcaatgcggttca
acgcacctggtctcggtcggcgtcggtaccgagcaattggaaaacgaactggcgccgctg
ttcccggaaacgccgatcacccgtattgaccgagacaccaccagccgcaagggctcgctc
gagcagcatctggcggatattcaccgtggtggctcacgcattttgatcggcacccagatg
ttggcaaaaggtcaccatttcccggacgtgacgctggtcgccctgctggacgtcgacggc
gcgctgttttcggctgatttccgttccgctgaacgctttgcccaactgtatacccaggtc
tccggccgtgcaggccgcgccggcaagcagggtgaagtccttttgcagactcaccacccg
gaacacccgctgctgcaaattctgttgcagcagggctacgaggccttttccaaacagacg
ctggcggaacgcaacagcgtcttcctgccgccctacaccagccatatcatcgtgcgttcg
gaagatcacgataaccaacaggcgccgctgttcctgcagcagttgcgcaacctgctggaa
gccagcccgctgaaagacgactcgttgtgggtcatggggcccgtcccggcattgcagtca
aaacgcggcggccgcttccgttggcaactgctgttgcagcacccttcgcgacgcgtgctg
caacagttgatgaaaagctcgttgccgttgatcggtacactgccacaggcacgtaaggtg
aaatggacgctggacgtcgatccgatagatagctga

DBGET integrated database retrieval system