KEGG   Serratia plymuthica 4Rx13: SOD_c46050Help
Entry
SOD_c46050        CDS       T02710                                 

Gene name
menA
Definition
(GenBank) 1,4-dihydroxy-2-naphthoate octaprenyltransferase
  KO
K02548  
1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC:2.5.1.74 2.5.1.-]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SOD_c46050 (menA)
Enzymes [BR:srl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.74  1,4-dihydroxy-2-naphthoate polyprenyltransferase
     SOD_c46050 (menA)
    2.5.1.-  
     SOD_c46050 (menA)
Prenyltransferases [BR:srl01006]
 Compound prenylation
  DHNA octaprenyltransferase
   SOD_c46050 (menA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5181907..5182824
Genome map
AA seq 305 aa AA seqDB search
MSSSTSTSPARAWLESLRPRTLPLAFASIVVGSAIAAWHDSLKPGVALLALLTAGLLQIL
SNLANDYGDAVKGSDKEDRIGPLRGMQKGMITQAQMKRALVVTVVLIAIAGCSLIAVACE
QPSDVIGFLVLGGLSIVAAITYTVGNKPYGYLGLGDISVLVFFGWLSVAGTYYLQTHAFD
SIVMLPATACGLLATAVLNINNLRDIESDRANGKNTLAVRLGPQKARYYHALLLIGAVAC
FALFTLLNLHSLWGWLFVLAIPLLVRHGLRVLRDPTPAGMRPMLEHMVKAALLANVLFAI
GVALS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagctcatcaacttccacctccccggccagagcctggcttgaaagtttacgaccgcgc
accctgccgctggcctttgcctcgatcgtggtcggttccgccattgccgcctggcatgac
agcctgaaacccggcgtggcgctgctggcactgctgaccgccggcttgctgcaaattctc
tccaatctggcgaacgactatggcgatgcggtaaaaggcagcgacaaggaagatcgtatc
ggaccgctacgcggcatgcagaaaggcatgatcacccaggcacagatgaaacgcgcgctg
gtcgtgacggtggtattgattgccatcgccggttgttcgctgatcgccgtggcctgtgag
cagcccagcgacgtcatcggcttcctggtgctgggcgggctttctatcgtcgccgccatt
acctacaccgtaggtaacaagccttacggttatctgggattgggcgatatttcggtgctg
gtgttctttggttggctgagcgtagcgggcacctactacctgcaaacccacgcttttgac
agcatagtgatgttgccggccaccgcctgcggtctgctggcaaccgcggtactcaatatc
aataacctgcgcgatatcgaaagcgatcgcgccaacggcaaaaataccctggcggtgcgg
ctcggcccgcagaaggcgcgctactaccacgccctgctgctgattggtgcggttgcgtgt
tttgcgctgtttacgctgcttaatctgcatagcctgtggggttggctgtttgtgctggct
atcccgctgctggtgcgtcatggcctgcgcgtgctgcgcgatccgaccccggccggcatg
cggccgatgctggaacatatggtcaaggcggcgctgctggccaacgtattgttcgccatc
ggcgtggcgctcagttaa

DBGET integrated database retrieval system