KEGG   Serratia plymuthica 4Rx13: SOD_c46080Help
Entry
SOD_c46080        CDS       T02710                                 

Gene name
glpF
Definition
(GenBank) glycerol uptake facilitator protein GlpF
  KO
K02440  
glycerol uptake facilitator protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transporters [BR:srl02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SOD_c46080 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5184222..5185067
Genome map
AA seq 281 aa AA seqDB search
MSQTTSPTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASFGQWEISIIWGLGVAMAIYL
TAAISGAHLNPAVTIALWLFACFDGRKVLPYIVAQIAGAFCAAALVYGLYYNLFFDFEAA
NHMVRGSDESLALAGIFSTYPNAHISVGQAFLVETVITAILMCLILALTDDGNGIPRGPL
APLLIGILIAVIGASMGPLTGFALNPARDFGPKLFAYLAGWGKVAFTGARDIPYFLVPIF
GPILGAGLGAFGYRALIGRHLPCDVCVEEEEPATKAQQRKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaccaccagtccgaccctaaaaggccagtgtatcgccgagttcctcggcaca
ggtttgttgatcttttttggcgtaggctgcgttgccgcactgaaactggcgggcgccagc
ttcggccagtgggaaatcagtatcatttggggcctgggcgttgccatggccatctatctg
actgctgccatctccggtgcgcaccttaacccggccgtcactatcgcgctgtggttgttc
gcctgctttgacggacgcaaagtactcccttacattgtcgcgcagatcgccggagccttc
tgcgcagcagccctggtctacgggttgtattacaacctgttcttcgatttcgaagcggcc
aaccatatggtccgcggcagcgacgagagccttgctctggccggtatcttctccacttat
cctaacgcgcacatctccgtcggccaggccttcctggtggaaacggtgattaccgcgatt
ctgatgtgcctgattctggcgctgaccgacgacggcaacggtattccacgtggcccgctg
gcaccgctgctgatcggtattctgattgccgttatcggcgcctccatgggcccattgacc
ggctttgctttgaacccggcgcgtgatttcggcccgaaactgttcgcttatctggcaggt
tggggcaaagtggccttcaccggggcacgtgatatcccgtacttcctggtgccaatcttt
ggccctatcctcggtgccggtctgggtgccttcggctaccgtgctctgattggccgccat
ctgccgtgcgatgtttgcgtagaggaagaagaacccgctaccaaggcccaacagcgcaaa
gcgtga

DBGET integrated database retrieval system