KEGG   Serratia plymuthica 4Rx13: SOD_c46130Help
Entry
SOD_c46130        CDS       T02710                                 

Gene name
fpr
Definition
(GenBank) ferredoxin--NADp reductase Fpr
  KO
K00528  
ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     SOD_c46130 (fpr)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     SOD_c46130 (fpr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5189899..5190645
Genome map
AA seq 248 aa AA seqDB search
MADWVNGKVTQVEQWTDGLFSITVHAPIDTFTAGQFAKLALEVDGERVQRAYSYVNAPSD
PNLEFYLVTVPEGKLSPRLNQLRPGSEVMVTKEAAGFFVLEEVPECDTLWMLATGTAIGP
YLSILQEGKDLERFKNLVLVHATRFARDLSYLPLMQQLQQRYNGKLRIQTVVSREDAAGS
LTGRVPALIEDGRLEAAVGLPLDAETCHVMLCGNPQMVRDTQQTLKDQRQMRKHLRRKPG
HMTSEHYW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgactgggttaatggcaaggttacgcaggtagagcaatggaccgacgggctgttc
agcattaccgtccatgcccctattgatacctttaccgccgggcaatttgccaaactggcg
ctggaagttgacggtgagcgcgtgcagcgcgcctattcctacgtcaatgcgcccagcgat
ccgaatctggagttttacctggttaccgtgccggaaggcaaactgagcccgcggctcaat
caactgcgaccgggatcggaagtgatggtgaccaaagaggccgccggtttcttcgtgctg
gaagaagtgccggagtgcgacaccctgtggatgttggcgaccggtaccgccatcggccct
tacctgtccatcctgcaggaaggcaaagacctggaacgcttcaaaaatttggtgctggtg
catgccacccgctttgcgcgcgatctcagctacctgccgctgatgcagcaattgcagcag
cgctacaacggtaagctgcgcattcagaccgtcgtcagccgcgaagacgccgcaggttca
ctgaccgggcgcgtgccggcgctgatcgaagacggccggctggaagcggcggtggggttg
cccctagatgccgaaacctgccacgtcatgctgtgcggtaacccgcagatggtgcgagac
acccagcagacgctgaaggatcagcggcagatgcgtaaacatctgcgccgcaagccgggc
catatgaccagcgagcattactggtaa

DBGET integrated database retrieval system