KEGG   Serratia plymuthica 4Rx13: SOD_c46140Help
Entry
SOD_c46140        CDS       T02710                                 

Gene name
yiiR
Definition
(GenBank) YiiR
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5190654..5191079)
Genome map
AA seq 141 aa AA seqDB search
MTLQQWCFSFKGRIGRRDFWIWMGAWLVLMAVAFTLANYQLVAIQSIAFFIVALLWPTAA
VLIKRLHDRNKAGWWALLLILAWMLAAGNWQMLAPIWQWGVGRFIPTLILVMMMIDLGAF
VGTPGNNRFGPEAEPVRFRRK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacagcagtggtgtttttcttttaagggccgtatcgggcggcgtgacttctgg
atttggatgggtgcctggctggtattgatggccgtcgcctttacgctggcgaattaccaa
ctggtggctatccagtcgatagcgttctttatcgttgcgttgctgtggccaactgcggcg
gtgctgatcaagcgcttgcacgatcgcaacaaggccggctggtgggcgctgctgttgatt
ctggcgtggatgctggcggcgggcaattggcagatgctggcgccaatctggcagtggggc
gtcgggcgttttatcccgacgctgattctcgtgatgatgatgattgatctgggcgccttt
gtcggcaccccagggaacaaccgtttcggcccggaagccgagccggtcaggttccgcagg
aaataa

DBGET integrated database retrieval system