KEGG   Serratia plymuthica 4Rx13: SOD_c46160Help
Entry
SOD_c46160        CDS       T02710                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c46160 (tpiA)
   00051 Fructose and mannose metabolism
    SOD_c46160 (tpiA)
   00562 Inositol phosphate metabolism
    SOD_c46160 (tpiA)
Enzymes [BR:srl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SOD_c46160 (tpiA)
Exosome [BR:srl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SOD_c46160 (tpiA)
  Exosomal proteins of bladder cancer cells
   SOD_c46160 (tpiA)
  Exosomal proteins of melanoma cells
   SOD_c46160 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5191998..5192765
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRNELSSVDGCGVAIAPPVMYLDQAKHALAGSRIA
LGAQNVDVNLSGAFTGEVSADMLKDVGAQYIIIGHSERRTYHKETDAAIAEKFAVLKAAG
LIPVLCIGETDAENEAGKTEEVCARQIDAVLKTQGAEAFKGTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAEVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaagcttaacggcagcactcacatggttaac
gaactcattgccgctctgcgcaatgaactgagcagcgttgacggttgtggcgtggctatc
gcaccgccggtgatgtacctggatcaggccaagcacgctctggccggcagccgcattgct
ctgggcgctcaaaatgtagacgtgaacctgtccggtgcattcaccggcgaagtttccgct
gacatgctgaaagatgtaggcgcgcaatacatcatcatcggccactccgaacgtcgcact
taccacaaagaaaccgacgctgcgatcgccgaaaaatttgccgtgctgaaagcggccggt
ctgatcccggtgctgtgcatcggtgaaaccgatgcagaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgccagatcgacgccgtgctgaaaacccagggcgctgaagcgttcaaa
ggtaccgttatcgcttatgagccagtttgggccatcggtaccggcaagtcagctacgcct
gcgcaagcacaggcagtacacaaatttatccgcgatcacatcgccaagcaggacgcagcc
gtagctgcagaagtgatcatccagtacggcggttctgtaaacgataagaatgctgccgag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatcactgaaagctgac
gctttcgccgtgatcgtcaaagccgctgcagccgctaaaaaagcctga

DBGET integrated database retrieval system