KEGG   Serratia plymuthica 4Rx13: SOD_c46170Help
Entry
SOD_c46170        CDS       T02710                                 

Gene name
sbp
Definition
(GenBank) sulfate-binding protein Sbp
  KO
K02048  
sulfate transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SOD_c46170 (sbp)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SOD_c46170 (sbp)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    SOD_c46170 (sbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5192832..5193821)
Genome map
AA seq 329 aa AA seqDB search
MRKWGVGLTIMLLASGAMAKDIQLLNVSYDPTREFYQEYNTAFGKYWQQQTGDKVTVRQS
HGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKDWIKRLPDNSAPYTSTIVFLV
RKGNPKQIHDWADLIKPGVSVITPNPKTSGGARWNYLAAWGYALHHNNNDKAKAQEFVKN
LYKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLAEKELGKDKFEIITPSESILAEP
TVSVVDKVVDKRGTRDVATAYLKYLYTPEGQTIAAKNYYRPRDAAVAAKFADQFPKLKLF
TVDDTFGGWTEAQKVHFATGGVFDEISKR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatggggtgtaggtctgacaataatgctgctggcgtccggtgccatggcgaaa
gatatccaactgctgaacgtttcgtacgacccgacgcgtgagttctatcaggaatacaac
accgcattcggtaagtactggcagcagcaaaccggcgataaagtgacggtgcgtcagtcg
catggcggttccggcaagcaggccacctcggtgattaacggtattgaggccgacgtggtt
acactggcgctggcctatgatgtggatgccatcgccgagcgtgggcgcatcgacaaagac
tggattaaacgtctgccggacaactccgcgccttatacctcgaccatcgtgttcctggtg
cgcaaaggtaacccaaaacaaattcacgactgggccgatttgattaaaccgggcgtgtcg
gtgattacaccgaatccgaaaacctccggcggtgctcgttggaactatctggctgcctgg
ggttacgcgctgcaccacaacaataacgataaagccaaggcgcaggagttcgtgaaaaac
ctgtataaaaacgttgaagtgctggattccggtgcgcgtggctcgaccaataccttcgtt
gaacgcggtatcggcgacgtgctgattgcctgggaaaacgaagcgttgttggcggaaaaa
gagctgggcaaagacaagtttgaaattatcaccccgagcgaatcgattctggcggagccg
accgtctcagtggtagataaagtggtcgataagcgcggcactcgcgatgtggcaacggct
tacctgaagtatctgtatacgccggaagggcagaccatcgcggcgaaaaactactatcgc
ccgcgtgatgcggcggtggcggccaagtttgccgaccagttcccgaaactgaagctgttc
accgtggatgataccttcggcggctggaccgaagcgcagaaggtgcactttgccaccggc
ggcgtgttcgacgagatcagcaagcgctga

DBGET integrated database retrieval system