KEGG   Serratia plymuthica 4Rx13: SOD_c46190Help
Entry
SOD_c46190        CDS       T02710                                 

Gene name
fieF
Definition
(GenBank) cation-efflux pump FieF
  KO
K13283  
ferrous-iron efflux pump FieF
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transporters [BR:srl02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SOD_c46190 (fieF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5195200..5196102)
Genome map
AA seq 300 aa AA seqDB search
MEPQYARLVKSTALAATVLASTLLLIKIVAWYRTGSVSLLAALVDSLVDVAASLTNLLVV
RYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFQHLYSPETLRDPGIGIAV
TIVALVSTLILVTYQRWVVRKTRSQAVRADMLHYQSDVMMNGAILIALGLSWYGFQRADA
LFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQAIIDVISSWPGVKGAHDLRTRQSG
PTRFIQLHLEMDDELPLMQAHILAEQVEQALLHRFPGADVLIHQDPCSVVPSGRQGHWEL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcaatatgcgcgtttggtgaagtccaccgcgttagctgccaccgtgttggcc
tccacgctgttactgataaaaattgttgcctggtatcgcaccggttcggtgagcctgctg
gctgcgctggtggattccctggtggatgttgccgcgtcgctgactaacctgctggtggtg
cgttactcgctgcaaccggccgatgaggagcacaccttcgggcatggtaaggcggagtcg
ctggcggcgctggcgcaaagcatgtttatttccggctcggcgctttttctgtttctgacc
ggttttcagcatctgtattcgccggaaaccttgcgtgaccccggcataggtattgccgtg
acaatcgttgcgctggtcagcaccctgatcctggtcacatatcagcgttgggtggtaaga
aaaactcgcagccaggccgtgcgagcagatatgctgcattatcagtcagatgtcatgatg
aatggtgctattcttattgcgcttgggctaagctggtacggtttccagcgggcagatgcg
ctgtttgcattgggaattggcgtctacattctctatagcgcgctgcggatgggctatgaa
gcggtacaatcgctgctggacagagcattgccggatgacgagcgccaggcgattatcgac
gtaatttcttcctggccgggggtgaaaggcgcgcacgatctgcgcacacgccagtccggc
ccgacgcgttttatccagttgcatctggaaatggacgatgagctgccgctgatgcaggcg
catattctggccgaacaggtggagcaggcgctgttgcaccgttttccgggggcggatgtc
ctcatccaccaagatccttgttccgtggtgccatcgggccggcaggggcattgggagcta
taa

DBGET integrated database retrieval system