KEGG   Serratia plymuthica 4Rx13: SOD_c46240Help
Entry
SOD_c46240        CDS       T02710                                 

Definition
(GenBank) CHAD domain containing protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5199530..5200303
Genome map
AA seq 257 aa AA seqDB search
MAFTESIIAHFRRLENALNQALARLQDTTDTEALHDVRINLRRIRSLLRPLRGTPGVAQL
DNAAASLGKLTTPIRDLEVLIAELARHPLEWQTNVRKTELQSRNLALASHPLLFRFPNLL
HDWPKSFHKAKRRHAKRRVAHRLSRQVKQLRLALADGHYDRHRLRLLIKRLRYVTDAYPQ
FSLITPEAAASLKEAQNALGDWHDRFVWCRQAENQQDLWPLLPEWQDAQETALERAEAAL
FALSRALTSKTRDASRS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctttcactgagagtattatcgcccacttccgcaggctcgagaatgcgctgaatcag
gcgctggcgcgtttgcaggacacgacggacactgaggctctgcacgacgtacgcatcaac
ctgcggcgaatcaggagcctgctgagaccattgcgcggcacacccggcgtcgcacaactc
gacaacgccgccgccagcctggggaaactcaccacgccgatacgcgatttggaagtgttg
atcgccgagttggcgcgacatccgctagagtggcagaccaacgtccgcaaaaccgaattg
caaagccgcaacctcgcccttgcgtcacatcccttgctgttccgctttcccaacttgctg
cacgactggccaaaaagcttccataaagccaaacgccggcacgcaaaacgtcgcgttgcc
catcgcctgtcccggcaggtgaaacagctgcgtctggcgctggccgacgggcactacgat
cgccaccggctgcgcctgctgatcaagcggttgcgctatgttaccgacgcctacccacag
ttctcgcttatcacaccggaagccgccgccagcctgaaagaggcgcaaaatgcactggga
gactggcacgatcgttttgtctggtgccggcaagccgaaaatcagcaagatctctggccg
ctgctgccagaatggcaagacgctcaggaaacagcgctggagagggctgaagctgcattg
tttgcgctttcgcgggcgctcacctctaaaacccgcgacgcatcacgatcctga

DBGET integrated database retrieval system