KEGG   Serratia plymuthica 4Rx13: SOD_c46260Help
Entry
SOD_c46260        CDS       T02710                                 

Gene name
cysE
Definition
(GenBank) serine acetyltransferase CysE
  KO
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SOD_c46260 (cysE)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SOD_c46260 (cysE)
Enzymes [BR:srl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     SOD_c46260 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5201148..5201969)
Genome map
AA seq 273 aa AA seqDB search
MSSEELEQVWKSIKSEARELAECEPMLASFFHATLLKHENLGSALSYILANKLANPIMPA
IAVREVVEDAYLADKQMIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWL
WLQGRQALAIYLQNQISVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSV
TLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGKGAKIGAGSVVLQSIPPHTTAAGVP
ARIVGRPESDTPSMDMDQYFNGTNQGFEFGDGI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagaagagttagagcaggtctggaagagcatcaaatcagaagcgagagagctg
gctgagtgtgaaccgatgctggctagctttttccatgcgacgttgctcaagcatgaaaac
ctgggcagtgcgctcagctatattctggcaaacaagctggcaaatccgattatgccggct
attgcggtgcgtgaagtggtggaagacgcctaccttgccgataagcagatgatcgtctcg
gcagcgcgcgatatcctggcggtgcgtttgcgcgacccggcggtagataaatactcgacg
ccgttgctgtatctgaaaggtttccatgcgctgcaggcttaccgtatcggccactggctg
tggttgcaggggcgccaggcgttggcgatttacctgcaaaatcaaatttcggtcgccttt
ggcgttgatattcaccctgcggccactattggctgcggtattatgctcgaccatgccacc
ggcatcgttattggtgaaaccgcagtagtggaaaacgacgtgtctatcctgcagtcggtc
acccttggcggtaccggcaaaaccagcggcgatcgtcatccgaagatccgagagggcgta
atgattggcgccggggctaaaattctcggcaatatcgaggtgggcaaaggcgcaaaaatc
ggtgccggctcggtagtattgcaatccataccgccgcataccaccgccgccggggtgccg
gcgcgcatcgtcggccgaccggaaagcgatacgccttcgatggatatggatcagtacttc
aacggcaccaatcagggttttgagttcggcgacggcatttaa

DBGET integrated database retrieval system