KEGG   Serratia plymuthica 4Rx13: SOD_c46280Help
Entry
SOD_c46280        CDS       T02710                                 

Gene name
secB
Definition
(GenBank) protein-export protein SecB
  KO
K03071  
preprotein translocase subunit SecB
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:srl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    SOD_c46280 (secB)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    SOD_c46280 (secB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SOD_c46280 (secB)
Chaperones and folding catalysts [BR:srl03110]
 Other chaperones and cochaperones
  SecB
   SOD_c46280 (secB)
Secretion system [BR:srl02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   SOD_c46280 (secB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5203159..5203629)
Genome map
AA seq 156 aa AA seqDB search
MSEQNSTEMAFQIQRIYTKDISFEAPNAPQVFQQEWQPEVKLDLDTASSQLADEVYEVVL
RVTVTASLGEETAFLCEVQQAGIFSVAGIDGTQLAHCLGAYCPNILFPYARECITSLVSR
GTFPQLNLAPVNFDALFMNYLQQQAEGEGAAPHQDA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaaaacagcacagagatggctttccagattcagcgcatttacaccaaggat
atctccttcgaagcgccaaacgctccgcaggttttccagcaggaatggcagccagaagtt
aaactggatctagataccgcttccagccagttggctgacgaagtgtatgaagttgtactg
cgcgtaaccgtgactgcgtctctgggcgaagaaactgcgttcctgtgtgaagtgcagcag
gcgggcatcttctccgttgcaggcatcgacggcacgcagctggcgcattgcctgggtgca
tactgcccgaacattctgttcccgtatgcgcgtgagtgcatcaccagcctggtttctcgc
ggcacattcccgcaactgaacctggcaccggttaacttcgacgcgctgttcatgaactat
ctgcaacagcaggcggaaggcgaaggtgccgcaccacatcaggatgcctga

DBGET integrated database retrieval system