KEGG   Serratia plymuthica 4Rx13: SOD_c46310Help
Entry
SOD_c46310        CDS       T02710                                 

Gene name
gpmI
Definition
(GenBank) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00010  Glycolysis / Gluconeogenesis
srl00260  Glycine, serine and threonine metabolism
srl00680  Methane metabolism
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
srl01200  Carbon metabolism
srl01230  Biosynthesis of amino acids
Module
srl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srl_M00002  Glycolysis, core module involving three-carbon compounds
srl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c46310 (gpmI)
  Energy metabolism
   00680 Methane metabolism
    SOD_c46310 (gpmI)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOD_c46310 (gpmI)
Enzymes [BR:srl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SOD_c46310 (gpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Sulfatase
Motif
Other DBs
NCBI-ProteinID: AGO57567
UniProt: S0AM03
Position
5204597..5206243
Genome map
AA seq 548 aa AA seqDB search
MRVVKSGGFKVNSHHSDCGQMAIHNLKVHNEVNAMSSNKKPMVLVILDGYGHREEQQDNA
ILNAKTPVMDRLWQQQPHTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDK
EIKDGDFFANPTLTAAVDKAVQAGKAVHIMGLLSPGGVHSHEDHILAMIELAAQRGAKAV
YLHAFLDGRDTPPRSAENSLQRFSDAFAKLGAGRIASLIGRYYAMDRDNRWDRVQLAYAL
MNEAQGDYVADNAVAALQAAYERGENDEFVKPTVLQAAGEASAALQDGDALIFMNFRADR
ARQIVRAFVNADFDGFPRAKVVNFGDFVMLTEYAADIKTPCAYPPASLNNTFGEWLMKHD
KTQLRISETEKYAHVTFFYNGGVEEPFKGEERVLVNSPKVATYDLQPEMSSAELTDKLLS
AISSGKYDAIICNYPNGDMVGHTGVYDAAVKAVETLDSCIAQVVEAVKAVDGQLLITADH
GNAEQMRDPATGQAHTAHTSLPVPLIYVGKPAHAVNGGKLSDIAPTMLTLMGMEIPKEMT
GKPLFIVE
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgttgtaaaatcgggcggttttaaggtgaatagccatcattccgattgcgggcag
atggctattcacaacttaaaagttcataacgaggttaatgcaatgtcgagtaacaaaaag
ccgatggtgctggtgatcctggacggctacggccatcgggaggagcaacaggacaatgcc
attctgaacgccaaaacgccggtgatggatcgcttgtggcaacagcagccgcataccctg
atcgccgcttccggcctggacgtgggcttgcctgatggccagatgggcaactcggaggtt
ggccacgtcaacctgggcgccggacgcatcgtttatcaggatctgacccgactggataaa
gaaatcaaagacggcgacttcttcgccaacccgacgctgacggcagcggtcgacaaggcc
gtacaagcgggcaaagcggtgcatatcatgggcctgctgtcgccgggcggcgtgcacagt
catgaagaccacattttggccatgattgaactggccgctcaacgcggcgcgaaagccgtg
tacctgcacgccttcctggacggccgcgacactccgccacgcagcgcagaaaactcgctg
caacgctttagcgacgcctttgccaaactgggcgccgggcgcatcgcctcgctgattggc
cgctattacgccatggaccgcgacaatcgctgggaccgtgttcaactggcttatgcactg
atgaacgaggctcagggcgattatgtggccgataacgccgttgccgcactgcaagccgct
tatgagcgcggcgaaaacgacgagttcgtgaaaccgaccgtgcttcaggccgccggtgaa
gcctccgccgctctgcaggatggcgacgcgctgattttcatgaacttccgcgccgatcgc
gcgcgccagatcgttcgcgccttcgtgaatgccgatttcgacggattcccccgcgccaag
gtggtgaatttcggtgatttcgtgatgttgaccgaatatgccgccgacatcaaaacccct
tgcgcctacccgccggcgtcgttaaacaacaccttcggcgaatggctgatgaagcacgac
aaaacgcagttgcgcatctcggaaaccgaaaaatacgcacacgtcacgttcttctataac
ggcggtgtggaagaaccgttcaaaggcgaagaacgcgtgctggtcaactcgccgaaggtc
gccacctacgatctgcaaccggaaatgagttcggcggagctgaccgacaaactgctgagt
gccatcagcagcggcaaatacgacgccattatctgcaactacccgaacggcgacatggtg
ggccataccggcgtttatgacgcggcggtgaaagcggtggaaaccctcgatagctgcatc
gcgcaggtcgtggaggccgttaaggccgttgacggacagctgttgatcaccgccgatcac
ggcaacgccgaacaaatgcgcgatccggccaccggtcaggcgcataccgcccacaccagc
ctgccggtgccgctgatttacgtcggcaagcctgctcacgcggtcaacggcggcaagctt
tccgatatcgcgccgaccatgttgacgctgatgggaatggaaatcccgaaagagatgact
ggtaagccgctgttcatcgtggaataa

DBGET integrated database retrieval system