KEGG   Serratia plymuthica 4Rx13: SOD_c46320Help
Entry
SOD_c46320        CDS       T02710                                 

Gene name
envC
Definition
(GenBank) murein hydrolase activator EnvC
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5206355..5207587
Genome map
AA seq 410 aa AA seqDB search
MCASVFCAGVLLLPLAGQAAEDNKSQLKDIQQSIAEKEKAVKQQQQQRSSLQDQLKQQEK
TIAQASRLLRDTQGTLSQLGKDISGLNASIAKLQKQQSTQQEILAKQLDAAFRQGQHSAV
QLILSGEESQRSERILAYFSYLNEARQQTIEELKQTRVELAKQKTTLVAKQGQQKSLLGE
QQTQQQKLEQARGARKQTLTALEASLEKDQQRLVELRQNETRMRDKIARAEREARARAER
EAREAAKVREQMRAKEQQAKKTGTSYKPSEADRSLIARTGGLGRPSGQAMWPVRGRTLHS
FGEQLQGELRWKGMVISAAEGSEVKAIADGRVLLADWLQGYGLVVVVEHGKGDMSLYGYN
QSALVNVGAQVRAGQPIALVGTSGGQGTPSLYFEIRRQGQAVNPLPWLGR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccagcgtattttgcgctggcgtcttgctgttgccgttagccggacaggcggcg
gaagacaacaaatcccagctcaaagacatccagcaaagcatcgccgaaaaagagaaggcg
gttaaacagcagcaacagcaacgcagctcattgcaggatcagcttaaacagcaggaaaaa
accatcgcgcaggccagccgcctgctgcgtgacacccagggcacgctaagccaactgggg
aaagacatttccggcctgaacgcctccatcgccaagctgcaaaagcagcagtctactcag
caagagatcctcgccaaacagctcgacgccgctttccggcaggggcaacacagtgcagta
caactgatcctcagcggtgaggagagccagcgcagcgagcgtattctggcttacttcagc
tatctgaacgaggcgcgtcagcaaactatcgaagaactgaagcaaacccgtgtcgagctg
gcaaaacaaaaaaccacgctggtggccaaacagggccagcaaaaatcgctgttgggcgaa
cagcaaacgcaacaacagaagctggagcaggcacgtggcgcacgtaagcaaacgctgacc
gcactggaagcctcgctggaaaaagatcagcagcggctggtggaactgcgtcaaaacgaa
acccgcatgcgcgataaaattgcccgagctgaacgcgaagcccgcgcccgtgccgaacgt
gaagcgcgtgaagccgccaaggtgcgcgagcaaatgcgcgccaaagaacagcaggcgaag
aaaaccggcaccagttacaaacctagcgaagccgaccgctcgctgattgcccggaccggc
ggccttggcagaccgagcggacaagcgatgtggccggttcgtggccgcaccttgcacagt
tttggtgaacaattgcagggcgagttacgctggaaaggcatggtgatctcggccgccgaa
ggcagcgaagtgaaagccattgccgacggccgcgtattgctggccgactggctgcaaggc
tatggtctggtcgtcgtagtcgagcacggtaagggcgacatgagcctgtatggctataac
cagagcgcgttggtcaacgtcggggcgcaggtccgcgccgggcagccgatagccttggta
ggcaccagcggaggccagggaacgccgtcgctttatttcgaaatccgtcgtcaaggtcag
gcggttaacccactaccgtggttgggaagatag

DBGET integrated database retrieval system