KEGG   Serratia plymuthica 4Rx13: SOD_c46330Help
Entry
SOD_c46330        CDS       T02710                                 

Gene name
yibQ
Definition
(GenBank) YibQ
  KO
K09798  
uncharacterized protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5207590..5208555
Genome map
AA seq 321 aa AA seqDB search
MRYIKTRTVVLIGCLLQVCAAQAGKLSIVIDDVGYRPHEEGAVLQMPTAISVAVLPNAPH
ARLMATRAHSQGREVLIHMPMAPLSKQPLERDTLQPSMSSEEIQRIIRNAVNNVPYAVGM
NNHMGSAMTSSLPGMQKVMQALESYRLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDD
TANEADIRRQFNRAVDLARRNGSAIAIGHPRPATVKVLQQMLPTLPADIVLVKPSSLLNE
PQSNSGGGSYVPPPVKPQKPQPKNPFTGGIKQCKVKLPKEKVNAGKAISVIGESVTQSPA
AEFIKRQWHRWVDSAPDKPKA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctatatcaaaacccgtactgtcgtattgattggctgtctgttgcaggtttgcgcc
gcgcaggcggggaagttgtccatcgttatcgatgacgtgggttatcggccgcacgaggaa
ggcgccgtgctgcaaatgccgacggcgatctccgttgccgtgctgcccaatgcccctcac
gcccgtctaatggccacccgcgcccacagccagggccgcgaagtgttgattcacatgcca
atggccccgctcagcaaacagccgttggagcgcgatacgctgcagccgtccatgagcagc
gaagagatccagcgcatcatccgcaatgcggtgaataacgtgccctacgcggtcgggatg
aacaaccacatgggcagcgccatgacctccagcctgccgggcatgcagaaagtcatgcag
gcgctcgaaagttaccgcctgtactttctcgatagcatgaccattggcaatagccaggcc
acccgtgccgctgcagggaccggggtgaaggtcatcaagcgtaaagtgtttctggacgat
accgccaacgaggccgatattcgccgccagtttaaccgtgcggtcgatctggcacgccgc
aacggttccgccatcgcgattggccatccacgtccggcgacggtaaaggtgctgcagcaa
atgctgccgacgttgccggccgatatcgtgctggtaaaacccagttcgctgctgaatgaa
ccgcagagtaacagcggcggcggcagttacgttccaccgccggtcaagccgcagaaaccg
cagccgaagaacccgttcaccggcggtatcaagcagtgcaaggtcaagttgccgaaggaa
aaagtcaacgcaggcaaggcgataagcgtgatcggcgaaagcgtgacacagtcgccggcg
gcagagtttatcaagcgccagtggcatcgctgggtcgactcagcgccagacaaaccgaaa
gcataa

DBGET integrated database retrieval system