KEGG   Serratia plymuthica 4Rx13: SOD_c46350Help
Entry
SOD_c46350        CDS       T02710                                 

Gene name
kbl
Definition
(GenBank) 2-amino-3-ketobutyrate coenzyme A ligase Kbl
  KO
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOD_c46350 (kbl)
Enzymes [BR:srl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     SOD_c46350 (kbl)
Amino acid related enzymes [BR:srl01007]
 Aminotransferase (transaminase)
  Class II
   SOD_c46350 (kbl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5209625..5210950)
Genome map
AA seq 441 aa AA seqDB search
MSSIKALCRDICCNFHILSCVLSSVWLQISKICGKQTHPGDNRMSASFYQQLEQQLATAR
SEGLFKEERIITTAQQADIAVADGRHVINFCANNYLGLANHPAMIAAAKAGMDSHGFGMA
SVRFICGTQDSHKQLERKLADFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDTLNHA
SIIDGVRLCKAKRYRYANNDMNELAAQLKQAKADGARHIMIATDGVFSMDGVIANLKGVC
DLADQYQALVMVDDSHAVGFVGANGRGTHEYCDVMGRVDIITGTLGKALGGASGGYTAAK
KEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLELLEQGDALRDRLWANASLFREKMTAAG
FELAGADHAIIPVMLGEAKLAQEFANALLKEGIYVTGFFYPVVPKGQARIRTQMSADHTP
EQIERAVAAFIRIGKDLGVIA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcatcaaagcactttgccgtgatatctgctgcaattttcatattctctcctgt
gtattgtcgtcagtttggttacaaatcagtaaaatatgtggaaaacagacccatcctgga
gataaccgaatgtccgcgtctttttatcagcagttggaacaacagcttgcaaccgcccgt
agcgaagggttgttcaaggaagagcgcattatcaccactgctcagcaggctgatatcgcc
gttgccgacggccgccatgtcatcaacttctgcgccaacaattaccttggcctggccaac
catccggcgatgatcgcggcggccaaggccggtatggacagccacggtttcggcatggcg
tcggtgcgctttatttgcggcacccaggacagccataagcagctggagcggaaattggcc
gattttctcggtatggaagacgccatcctgtattcctcttgcttcgatgccaacggcggg
ctgttcgaaacgctgcttgggccggaagacgcgattatctccgacacgctgaaccacgcg
tcgatcatcgacggcgtgcgtttgtgcaaggcgaagcgttaccgctatgccaataacgac
atgaacgagctggctgcacagctgaaacaggccaaggccgatggcgcgcgccacatcatg
atcgcaaccgacggcgtgttttccatggacggcgtgatcgccaacctgaaaggggtatgc
gacctggcggaccagtatcaggcgttggtgatggtggatgattcccatgcggtaggtttc
gttggcgccaacgggcgtggcacccacgaatattgcgacgtgatgggtcgcgtcgacatc
attaccggtaccctgggcaaagcgctgggcggcgcgtccggcggttataccgcggcgaaa
aaagaggtggtggagtggttgcgccagcgttcgcggccttatctgttctccaactcgctg
gcgccggcgattgtcgccgcttcgatcaaagtgctggaactgctggagcagggcgatgcg
ctgcgcgatcgtctgtgggccaatgcgagcctgttccgcgaaaaaatgaccgcggcgggc
tttgagctggccggggccgatcacgccatcatcccggtgatgttgggtgaagcaaagctg
gcgcaggagttcgccaacgcgctgctcaaggaaggcatttatgtgaccggtttcttctat
ccggtggtgccgaaaggccaggcgcgcatccgtacccagatgtctgctgaccacaccccg
gagcaaattgagcgtgcagtcgcggcgttcattcgtatcggtaaggatcttggcgttatt
gcataa

DBGET integrated database retrieval system