KEGG   Serratia plymuthica 4Rx13: SOD_c46490Help
Entry
SOD_c46490        CDS       T02710                                 

Gene name
kdtX
Definition
(GenBank) lipopolysaccharide core biosynthesis glycosyltransferase KdtX
  KO
K12984  
(heptosyl)LPS beta-1,4-glucosyltransferase [EC:2.4.1.-]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SOD_c46490 (kdtX)
Glycosyltransferases [BR:srl01003]
 Polysaccharide
  Bacterial polysaccharide
   SOD_c46490 (kdtX)
Lipopolysaccharide biosynthesis proteins [BR:srl01005]
 Core region
  SOD_c46490 (kdtX)
Transporters [BR:srl02000]
 Other Transporters
  Others
   SOD_c46490 (kdtX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5225472..5226245
Genome map
AA seq 257 aa AA seqDB search
MSDRKSLSVVIIAKNEAGLLPDCLNSVAWADEVVILDSGSQDDSIAIAENLGAKVFVHTD
WQGFGKQRQLAQSYASHDYILMIDADERVTPELRQSIEQTLAAPDDNQVYSCARRNLFLG
RFMRHSGWYPDRVNRLYANRRYRYNDDLVHESLNIGAAKVVPLSGDLLHLTCRDFFAFQR
KQLRYAEEWANQRHQAGKRCGYSSILTHTLGAFCKTWLLRAGFLDGKQGLLLAVVNAQYT
FNKYAALWALGRNSSEK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgcaaaagcctgtcggtggtgatcatcgccaagaacgaagccgggctgctg
ccggattgcctgaactctgtggcctgggcggacgaagtggtcattctcgattcgggcagc
caggatgacagcatcgccattgccgaaaacctcggtgccaaagtgttcgtccataccgac
tggcagggcttcggcaaacagcgccaattggctcaaagctacgccagccacgactatatt
ctgatgatcgacgctgacgagcgcgtcacccccgaactgcgccagtcgattgaacagacc
ttggccgcgcctgacgacaatcaggtctacagttgtgcgcgccgcaacctgttccttgga
cgttttatgcgtcacagcgggtggtatccggatcgcgtcaaccggctgtacgccaaccga
cgctatcgctataacgacgatctggtgcatgaatcgctcaatatcggcgccgcgaaagtg
gtacccctcagcggcgatctgctacacctgacctgtcgcgactttttcgctttccagcgc
aagcagttgcgttatgccgaagaatgggccaatcagcgtcatcaggccggcaagcgctgc
ggttactcctccatactgactcatactctcggtgccttctgcaaaacctggctgctgcgc
gccggcttcctcgacggtaaacaggggttgctgttagccgtggtcaacgcgcaatatacc
ttcaataaatatgccgcattgtgggcattgggccgcaactcttcagagaagtga

DBGET integrated database retrieval system