KEGG   Serratia plymuthica 4Rx13: SOD_c46530Help
Entry
SOD_c46530        CDS       T02710                                 

Gene name
rpmB
Definition
(GenBank) 50S ribosomal protein L28
  KO
K02902  
large subunit ribosomal protein L28
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:srl00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SOD_c46530 (rpmB)
Ribosome [BR:srl03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SOD_c46530 (rpmB)
  Bacteria
    SOD_c46530 (rpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5227803..5228039)
Genome map
AA seq 78 aa AA seqDB search
MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEAEKRFVTLRVSAKGMRVID
KKGIETVLADLRTRGEKY
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagtctgccaagttactggcaagcgcccggtgagcggtaacaaccgttcccac
gcaatgaacgcgaccaaacgccgttttctgccgaacctgcactcacaccgtttttgggtt
gaggctgagaagcgctttgtaacgctgcgtgtatctgctaaaggtatgcgtgttatcgat
aagaagggtattgagacggtcttggccgatctgcgtacccgtggtgagaagtattaa

DBGET integrated database retrieval system