KEGG   Serratia plymuthica 4Rx13: SOD_c46560Help
Entry
SOD_c46560        CDS       T02710                                 

Gene name
dut
Definition
(GenBank) deoxyuridine 5'-triphosphate nucleotidohydrolase Dut
  KO
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SOD_c46560 (dut)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     SOD_c46560 (dut)
DNA repair and recombination proteins [BR:srl03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SOD_c46560 (dut)
 Prokaryotic Type
    SOD_c46560 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5230363..5230821
Genome map
AA seq 152 aa AA seqDB search
MMKKIDVKILDPRIGQDFPLPTYATPGSAGLDLRACLDTAVELAPGETTLLPTGLAIHIA
DTDLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRGQKSFTIEPGERIAQM
VFVPVVQAEFNLVEEFDSSERGAGGFGHSGRH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaatcgacgttaaaatcctcgacccgcgtatcggacaggatttcccttta
ccgacctacgctaccccaggttcagccggtctcgatctgcgcgcctgcctggacaccgcg
gttgaactggcgccgggtgaaaccacgttgctgcctaccggtctggctattcacattgcc
gacaccgatctggcggcggtgatcttgccgcgctcaggtttgggccacaagcacggcgtg
gtgctgggcaacctggttggcctgatcgactccgactaccagggccaactgatggtttcc
gtctggaaccgcggccaaaaatccttcaccattgaacctggcgaacgtatcgcgcaaatg
gtctttgtgcctgttgtgcaagctgagttcaatctggtagaagagttcgacagcagcgaa
cgtggcgcaggtggctttggccactcgggtcgccactaa

DBGET integrated database retrieval system