KEGG   Serratia plymuthica 4Rx13: SOD_c46590Help
Entry
SOD_c46590        CDS       T02710                                 

Gene name
rph
Definition
(GenBank) ribonuclease pH
  KO
K00989  
ribonuclease PH [EC:2.7.7.56]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.56  tRNA nucleotidyltransferase
     SOD_c46590 (rph)
Transfer RNA biogenesis [BR:srl03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    SOD_c46590 (rph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5232584..5233300)
Genome map
AA seq 238 aa AA seqDB search
MRPAGRAPQQVRPLTLTRHYTKHAEGSVLVEFGDTKVLCTATVEEGVPRFLKGQGQGWIT
AEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDLKKLGEFTITLDCDVLQ
ADGGTRTASISGACVALADALNALVAAGKLKANPMKGLVAAVSVGIVKGEALCDLEYVED
SAAETDMNVVMMEDGRMIEVQGTAEGEPFSHDELLALLALARGGIETIFQAQKAALAE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctgcaggcagagcaccacaacaagttcgcccactgacactgacccgtcactat
accaaacacgctgaaggttcagtgctggttgagtttggcgataccaaagttttgtgcacc
gccacggtagaagagggcgttccgcgcttcctgaaaggtcagggccagggttggatcacc
gccgaatacggcatgctgccgcgctctacccacagccgtaacgctcgcgaggccgcaaaa
ggcaagcagggcggccgtacgctggaaattcagcgcctgatcgcccgttcgctgcgtgcg
gcggtcgatctgaaaaaactgggtgagttcaccattaccctggattgcgacgtactgcag
gctgatggcggcacccgcaccgcctccatttccggtgcctgcgttgcgctggctgatgcg
cttaatgcattggttgctgcgggcaaactgaaggccaacccaatgaaagggctggtagct
gcagtgtctgtcggtatcgtcaagggcgaagcgctgtgcgatctggagtacgtcgaagac
tctgcggcagaaaccgatatgaacgtggtgatgatggaagacggccgcatgatcgaggtg
cagggcaccgccgagggcgaacctttcagccacgacgagctgttggcgctgttggcgctg
gctcgagggggcatcgaaaccatcttccaggcgcagaaagcggcgctggcagagtaa

DBGET integrated database retrieval system