KEGG   Serratia plymuthica 4Rx13: SOD_c46610Help
Entry
SOD_c46610        CDS       T02710                                 

Gene name
nupC
Definition
(GenBank) nucleoside permease NupC
  KO
K03317  
concentrative nucleoside transporter, CNT family
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5235000..5236184
Genome map
AA seq 394 aa AA seqDB search
MPQILQFIFALVVIIALALLVSNDRKKIRLRYIIQLLVIEGALAYFFLHSESGLSVIRHV
AGFFETLLTYAAQGSDFVFGGMSKDGLAFIFLGVLCPIIFISALIGILQHFRILPLIIRL
VGTLLSKVNGMGKLESFNAVSTLVLGQSENFIAYKGIIGDISPRRMYTMAATAMSTVSMS
IVGAYMSMIDAQYVVAALILNMFSTFIILSIINPYQLDDEPELKLNKLHEDQSFFEMLGE
YILAGFKIAMIIAAMLIGFIALISAVNALFSAVFGISFQQILGYVFYPLAWLIGIPAQDA
LRAGSIMATKLVANEFVAMIELKKIATELSPRGLGILSVFLVSFANFASIGIVAGAIKGL
NERQGNVVSRFGLKLVYGSTLVSLLSAAIAGLVL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaattctgcaatttattttcgccctggtggtgatcatcgccctggcgttgctg
gtcagcaacgatcgcaagaaaatccgcctgcgctatattattcagctgttggtcattgaa
ggtgcactcgcctatttcttcctgcattcagaaagtggcctcagcgtaatcagacacgtc
gccggcttctttgaaacgctgctgacctacgcagcgcaaggctccgactttgttttcggt
ggcatgagcaaggacgggctggcgttcattttcctgggcgttttgtgcccgattatcttt
atttccgcgctaatcggtattttgcagcactttcgtattttgccgctgattatccgcctg
gtcggcaccctgctgtccaaggttaacggcatgggcaagctggagtctttcaacgccgtc
agcacgctggtactcggtcagtcggaaaacttcatcgcctataaggggatcatcggcgat
atttcgccgcgccgcatgtacaccatggccgcaaccgccatgtcgacggtctccatgtcc
atcgttggcgcctacatgtcgatgatcgatgcgcaatacgtggttgcggcactgatcctc
aatatgttcagcacctttatcattctgtcgatcatcaacccttatcaactggacgatgag
cctgaactgaaactgaacaaactgcatgaagatcagagcttctttgaaatgctgggcgaa
tacattctggcgggcttcaagattgcgatgattatcgccgcgatgctgattggttttatt
gcgctgatctctgcggtaaatgctctgttctcggccgtgttcggcatcagcttccagcaa
attctgggctacgtgttttatccgctggcctggttgatcggcatcccggcacaggatgcg
ttgcgggccggcagcatcatggcgaccaagttggtggccaatgaattcgtggcgatgatc
gagttgaagaaaattgcgacggaactgtcgccgcgcggcctgggtattttgtccgtgttc
ctcgtctcctttgccaactttgcctctatcggcatcgtcgccggggcgatcaaagggctg
aatgaacgacaaggcaacgtggtatcccgctttggtctgaagctggtctatggttcaacg
ctggtcagcctgctctcggcagccatcgcagggttggtgctgtaa

DBGET integrated database retrieval system