KEGG   Serratia plymuthica 4Rx13: SOD_c46680Help
Entry
SOD_c46680        CDS       T02710                                 

Gene name
rpoZ
Definition
(GenBank) DNA-directed RNA polymerase subunit omega
  KO
K03060  
DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SOD_c46680 (rpoZ)
   00240 Pyrimidine metabolism
    SOD_c46680 (rpoZ)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    SOD_c46680 (rpoZ)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SOD_c46680 (rpoZ)
Transcription machinery [BR:srl03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     SOD_c46680 (rpoZ)
DNA repair and recombination proteins [BR:srl03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      SOD_c46680 (rpoZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5242815..5243090
Genome map
AA seq 91 aa AA seqDB search
MARVTVQDAVEKIGNRFDLVLVAARRARQIQTGGKDALVPEENDKYTVIALREIEEGLIT
SQILDVRDRQEQQEQEAAEIQAVTAIAEGRR
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgtaactgttcaagacgctgtagagaaaattggtaaccgttttgacctggtg
ttggtcgctgctcgtcgggcacgtcaaatccagactggcggtaaagatgcacttgttccg
gaagaaaacgacaagtacaccgttatcgctctgcgcgaaatcgaagaaggcctgatcacc
agccagatcctcgatgttcgtgatcgtcaggagcagcaagagcaggaagccgcagaaatt
caagcggttaccgcaattgctgaaggtcgtcgttaa

DBGET integrated database retrieval system