KEGG   Serratia plymuthica 4Rx13: SOD_c46690Help
Entry
SOD_c46690        CDS       T02710                                 

Gene name
spoT
Definition
(GenBank) guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase
  KO
K01139  
GTP diphosphokinase / guanosine-3',5'-bis(diphosphate) 3'-diphosphatase [EC:2.7.6.5 3.1.7.2]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SOD_c46690 (spoT)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     SOD_c46690 (spoT)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     SOD_c46690 (spoT)
Ribosome biogenesis [BR:srl03009]
 Prokaryotic Type
  Other maturation factors
   SOD_c46690 (spoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5243262..5245220
Genome map
AA seq 652 aa AA seqDB search
MACILAEMRLDHETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLDKLKFQDK
KEAQAENFRKMIMAMVQDIRVVLIKLADRTHNMRTLGSLRPDKRRRIARETLEIYSPLAH
RLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILSEIEGRLNEAGIPC
RVSGREKHLYSIYLKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAHSLYKPRPGRV
KDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWAYKEKEQGETGT
TAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVELPAGATPVDF
AYAVHTDIGHACVGARVDRQPYPLSQSLSSGQTVEIITAPGARPNAAWLNFVVSSKARAK
IRQMLKNLKRDDSVGLGRRLLNHALGGSRKLAEIPPENIQHELDRMKLATLDDLLAEIGL
GNAMSVVVAKNLQGDQSNLGTSSGVRNLAIKGADGVLITFAKCCRPIPGDPIIAHVSPGK
GLVIHHESCRNIRGYQKEPEKFMAVEWDKDIEQEFIAEIKVDMFNHQGALANLTAAINAA
ESNIQSLNTEEKDGRVYSAFIRLTTRDRIHLANIMRKIRIMPDVIKVNRNRN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtggcctgcattctggcggaaatgcgtctcgaccatgagacgctgatggcagcgctgctg
catgacgtcatcgaagacaccccggccacctaccaggatatggaacaactgttcggcaag
agcgtcgctgaactggttgaaggcgtatccaagctcgacaagctgaagttccaggataag
aaagaagcccaggcggaaaacttccgcaaaatgatcatggcgatggtgcaggatatccgc
gtcgtgctgatcaagctggccgaccgcacgcacaatatgcgtaccctgggttcgctgcgt
cctgacaaacgtcggcgtatcgcgcgtgaaaccctggaaatctacagccccttggcccat
cgcctgggtattcaccacctgaagaccgagctggaagagctgggttttgaggcgttgtac
ccgaaccgctaccgtgtaatcaaagaagtggtgaaagccgctcgcggtaaccgtaaggag
atgatccaaaagattctctccgagatcgaaggccgattgaacgaagccggcattccttgc
cgcgtcagcgggcgagaaaagcatctgtattccatctacctcaagatgcacctgaaagaa
cagcggttccattcgattatggacatctatgcgttccgggtgatcgtgaaggaagtcgat
acctgttaccgcgtgctgggccaggcccacagcctgtataaaccgcgcccgggcagggtc
aaagactatatcgccattcccaaagccaacggctaccaatcgttgcacacatccctgatc
ggccctcacggcgtgccggttgaggtgcagatccgtaccgaagatatggatcagatggca
gaaatgggggtggccgcgcactgggcttataaagaaaaagaacagggcgaaaccggcact
accgcgcaaatccgcgcccagcgatggatgcaaagcttgttggagttgcagcaaagcgcc
ggcagttcatttgaatttatcgagagcgtgaaatccgatctgttcccggatgagatttac
gttttcaccccggaaggccgcatcgttgaactgcctgcgggcgcaacgccggtcgacttc
gcctacgcggtgcataccgatatcggtcatgcctgcgttggcgcccgcgtcgatcgccag
ccctatccgctgtcgcagtcgctgagcagcggtcagacggtggaaatcatcaccgcaccg
ggtgcccggccaaacgccgcctggctgaactttgtcgtcagctcgaaagcgcgcgccaaa
atccgccagatgctgaaaaacctcaagcgcgatgactcggtcggcctcggccgccgcttg
ctgaaccatgcgttgggcggcagccgcaaactggcagaaattccaccggaaaatatccag
cacgagctggatcgcatgaagctggcgaccctggacgatctgctggctgaaatcggcctc
ggcaatgccatgagcgtggtggtggcgaaaaacctgcagggtgaccaatccaacctgggt
acctcctccggggttcgtaacctggcgatcaagggcgcagacggcgtgctgatcaccttc
gccaaatgctgccgacctattccgggcgacccgatcattgcccacgtcagcccgggcaaa
gggctggtgatccaccatgaatcctgccgaaacatccgcggctaccagaaagagcctgag
aaattcatggcggtagagtgggataaggacatcgagcaggagttcatcgccgagatcaaa
gtggacatgtttaaccatcagggcgcgctggccaacctgacggcggccatcaacgcggcc
gagtccaatattcagagcttgaataccgaagagaaagacggccgggtttatagcgccttt
atccgcctgaccacccgcgatcgcatccatctggcaaatattatgcgtaaaatccgtatc
atgccggatgtgattaaagttaaccgtaaccgaaattag

DBGET integrated database retrieval system