KEGG   Serratia plymuthica 4Rx13: SOD_c46700Help
Entry
SOD_c46700        CDS       T02710                                 

Gene name
trmH
Definition
(GenBank) tRNA (guanosine(18)-2'-O)-methyltransferase TrmH
  KO
K00556  
tRNA (guanosine-2'-O-)-methyltransferase [EC:2.1.1.34]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.34  tRNA (guanosine18-2'-O)-methyltransferase
     SOD_c46700 (trmH)
Transfer RNA biogenesis [BR:srl03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    SOD_c46700 (trmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5245226..5245921
Genome map
AA seq 231 aa AA seqDB search
MSPERYARICEMLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGVHQVHAVWPTSRMRTL
VSSAAGSNSWVNVKTHRTISDAVTHLKDQGMQILATHLSARAVDFREVDYTRPTCVLLGQ
EKTGITEEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRHNAGMYLRTRSALDE
EEQQRLLFEGGYPVLANVAKRKGLPRPQIDQQGQVVADAEWWATMQATVRR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgaacgctatgcgcggatttgtgaaatgctggcaacccggcagccggatctg
acggtctgcctggaacaggtacacaaaccgcataacgtctccgccattatccgcaccgcc
gacgccgtcggcgtgcatcaggtgcatgccgtgtggccgacctcacgcatgcgtaccctg
gtttcctccgctgccggcagcaacagctgggtcaacgtaaaaacccaccgtaccatctct
gacgcagtgacccacctgaaagatcaaggtatgcagattctggcgacccacctttccgcc
cgcgcggttgatttccgcgaggtggattacacccgcccaacctgcgtgctgctgggccag
gaaaaaaccggtatcaccgaagaagcgctggccctggccgaccaggacatcatcattccg
atgatcggcatggtgcaatccctcaacgtgtcggtcgcctccgccttgatcttgtacgaa
gcgcagcgccaacgccacaacgccggcatgtacctgcgcacccgcagcgcgctggacgaa
gaagaacaacaacgcctgctgttcgagggcggctacccggtgctggccaacgtcgccaag
cgcaaagggctgccgcgcccgcagattgaccaacagggccaggtggtcgccgacgccgaa
tggtgggcaaccatgcaggcaacggtacgccgatga

DBGET integrated database retrieval system