KEGG   Serratia plymuthica 4Rx13: SOD_c46720Help
Entry
SOD_c46720        CDS       T02710                                 

Gene name
gltS
Definition
(GenBank) sodium/glutamate symport carrier protein GltS
  KO
K03312  
glutamate:Na+ symporter, ESS family
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transporters [BR:srl02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SOD_c46720 (gltS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5248057..5249268)
Genome map
AA seq 403 aa AA seqDB search
MFHLDTYGTLVAATLVLLLGGKCVTSIPLLRKYTIPAPVAGGLLVALLLLALKKFANWEI
SFDMSLKDPLMLAFFATIGLNANLARLRAGGRALMVFLFVVLGLLLVQNAIGIGMAKILG
LDPLMGLIAGSITLSGGHGTGAAWSKLFIERYGFENATEVAMACATFGLVLGGLIGGPVA
RYLVKHSSTPEGTPEDSVQPSGFEKPESGRLITSLVMIETIAMIAICLSLGQFIAGLLNG
TVFELPNFVCVLFVGVILSNTLAFSGFYTVFERAVSVLGNVSLSLFLAMALMSLRLWELA
SLALPMLAILAVQTLVMALYAIFVTYRVMGKNYDAAVLAAGHCGFGMGATPTAIANMQAI
TDRFGPSHLAFLVVPMVGAFFIDIANAIVIKLYLLLPVFPAVG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatcttgatacttatggcacgttagtcgcggcaacgctggttttgctccttggg
ggcaaatgcgtcacaagcattccgctgttgcgaaaatacactattcccgcacctgtcgcc
ggtgggttgctggtggcgctcttgttgttagccctgaaaaagtttgctaactgggaaatc
agcttcgatatgtcgctgaaagacccgttgatgctggccttcttcgccaccatcggcctg
aatgccaacctggcgcggttgcgcgcgggtggcagagcgctaatggtgttcctgtttgtg
gtgctgggcctgctgctggtgcagaacgccattggcataggcatggcgaaaatactgggc
ttggatccgctgatgggcctgatcgccggttcaattacgctatccggcggtcatggtacc
ggcgcagcctggagcaagctgtttatcgaacgctatgggtttgaaaacgcgaccgaagtg
gcgatggcctgtgcgactttcggcctggtgctgggcggcctgatcggtggtccggtggcg
cgttacctggtgaaacactcctctacgccggagggcacaccggaagatagcgtgcaacct
agcggttttgaaaagccggaaagcggtcgactgatcacgtccttggtgatgatcgaaact
atcgcgatgatcgccatctgcttgagcctgggccagtttattgccggtctgttgaatggc
acggtgtttgaattgccaaactttgtttgcgtgctgtttgtcggcgtgatcctcagcaat
acgctggcgttcagcggtttttacaccgtgttcgaacgggcggtgtcggtgctagggaac
gtcagcctgtcactgtttctggccatggcgctgatgagcctgcgcctgtgggagttggcg
tcgctggcgctgccgatgctggcgattctggctgtgcagacgctggtgatggcgctctac
gcgattttcgtcacttaccgggtgatgggtaaaaactacgatgcggcggtactggctgcg
ggccactgtggttttggaatgggcgccacgccaacggcgatcgccaatatgcaggcgatt
accgatcgcttcggtccctcgcatctggcgtttctggtggtgccgatggtgggggcgttc
tttatcgatatcgccaacgcgatcgtgattaagctgtatctgctgttgccggtattcccg
gcggtgggctga

DBGET integrated database retrieval system