KEGG   Serratia plymuthica 4Rx13: SOD_c46760Help
Entry
SOD_c46760        CDS       T02710                                 

Gene name
dtd
Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase Dtd
  KO
K07560  D-tyrosyl-tRNA(Tyr) deacylase [EC:3.1.-.-]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SOD_c46760 (dtd)
Transfer RNA biogenesis [BR:srl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    SOD_c46760 (dtd)
 Prokaryotic Type
    SOD_c46760 (dtd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase
Motif
Other DBs
NCBI-ProteinID: AGO57612
UniProt: S0AM67
Position
complement(5253713..5254150)
Genome map
AA seq 145 aa AA seqDB search
MIALIQRVLNASVTVKGETVGKIGPGLLVLLGVEQDDNEQKAVRLCERVLGYRIFGDEND
KMNLNVQQAGGSLLVVSQFTLVADTQKGMRPSFSRGAVPQEADRLYQYFVGQCRERGVET
QTGEFAADMQVALVNDGPVTFWLQV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgttaatacaacgggtgttaaacgccagcgtcacggtcaagggagagacggta
ggcaagattggccccggtttgttagtgttattgggcgtggagcaggacgataacgagcaa
aaagccgtgcgcctgtgtgaacgcgtgctggggtatcgcatctttggcgacgagaacgac
aagatgaatctcaatgtccagcaggcgggaggcagcctgttggtggtttcgcagttcacg
ctggtggccgatacccaaaaaggcatgcgcccgagtttctcacgtggtgcagtaccgcag
gaggccgatcggttgtatcaatattttgttggccagtgccgcgaacgcggcgtagaaaca
cagaccggggagttcgccgccgacatgcaagtggcgctggtgaatgatggaccggtgacg
ttttggcttcaagtctaa

DBGET integrated database retrieval system